Property Summary

NCBI Gene PubMed Count 27
Grant Count 65
R01 Count 4
Funding $27,117,815.36
PubMed Score 95.97
PubTator Score 18.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma -2.300 0.006
medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -3.900 0.000
primitive neuroectodermal tumor -1.400 0.044
lung cancer 3.000 0.000
pediatric high grade glioma -1.700 0.009
posterior fossa group A ependymoma -1.200 0.002
lung carcinoma 1.900 0.000

Synonym

Accession P26232 B3KXE5 B7Z2W7 B7Z352 B7Z898 Q4ZFW1 Q53R26 Q53R33 Q53T67 Q53T71 Q53TM8 Q7Z3L1 Q7Z3Y0
Symbols CAPR
CTNR
CAP-R
CT114

Gene

Gene RIF (14)

PMID Text
25824743 Single nucleotide polymorphism in CTNNA2 is associated with breast cancer susceptibility.
25041903 CTNNA2 gene increases the risk of alcohol addiction in White women.
24100690 CTNNA2 and CTNNA3 are tumor suppressor genes frequently mutated in laryngeal carcinomas.
23077317 HIV-1 gp41 and alpha-catenin co-localize in gp160 and GST-alpha-catenin expressing cells; the leucine zipper-like domain (gp160 residues 791-824) of gp41 interacts strongly with the carboxy terminus (residues 795-906) of alpha-catenin
22833195 Common variants in CTNNA2 are associated with excitement-seeking and risk-taking.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18839057 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVLAASVEQATQN      1 - 70
FLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAARALLSAVTRLLIL     71 - 140
ADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAAR    141 - 210
GALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAAL    211 - 280
NEFDNKIILDPMTFSEARFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYM    281 - 350
NNTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV    351 - 420
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWE    421 - 490
KQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMEN    491 - 560
YEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVYDGVRDIRKAVLMI    561 - 630
RTPEELEDDSDFEQEDYDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAE    631 - 700
VAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSA    701 - 770
CKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHL    771 - 840
PTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVNSPVVSWKMKA    841 - 910
PEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF                               911 - 953
//

Text Mined References (30)

PMID Year Title
25824743 2015 A pilot genome-wide association study of breast cancer susceptibility loci in Indonesia.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25041903 2014 TARV: tree-based analysis of rare variants identifying risk modifying variants in CTNNA2 and CNTNAP2 for alcohol addiction.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
24124408 2013 Genome-wide association study of orthostatic hypotension and supine-standing blood pressure changes in two korean populations.
24100690 2013 Cell-cell adhesion genes CTNNA2 and CTNNA3 are tumour suppressors frequently mutated in laryngeal carcinomas.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
22833195 2011 Meta-analysis of genome-wide association studies identifies common variants in CTNNA2 associated with excitement-seeking.
21708131 2011 Bidirectional transcription from human LRRTM2/CTNNA1 and LRRTM1/CTNNA2 gene loci leads to expression of N-terminally truncated CTNNA1 and CTNNA2 isoforms.
More...