Property Summary

NCBI Gene PubMed Count 32
PubMed Score 15.26
PubTator Score 14.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.200 1.6e-05
medulloblastoma, large-cell -1.300 9.1e-04
sonic hedgehog group medulloblastoma -1.300 1.7e-05

Gene RIF (14)

AA Sequence

MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRYGR      1 - 70
EGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDLGPFSELQNRGSRHSGPFFTF     71 - 140
SSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRITTRRIMENGQERVEVEEDGQLKSVTINGVPD    141 - 210
DLALGLELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQ    211 - 280
HRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASRCLIL                              281 - 324
//

Text Mined References (35)

PMID Year Title