Property Summary

NCBI Gene PubMed Count 19
PubMed Score 150.96
PubTator Score 58.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.400 1.2e-03

Gene RIF (3)

AA Sequence

MAEEGIAAGGVMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCA      1 - 70
EHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYFKCKK             71 - 132
//

Text Mined References (31)

PMID Year Title