Property Summary

NCBI Gene PubMed Count 102
PubMed Score 178.80
PubTator Score 192.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active ulcerative colitis 1.442 2.2e-02
adult high grade glioma 1.900 7.7e-04
Astrocytoma, Pilocytic 4.500 1.1e-07
Breast cancer -1.100 3.9e-02
chronic rhinosinusitis 3.624 1.1e-02
cystic fibrosis -2.900 2.0e-04
ependymoma 1.300 1.8e-02
fibroadenoma 2.400 1.7e-02
glioblastoma 1.900 9.8e-04
interstitial cystitis -2.600 5.4e-04
intraductal papillary-mucinous adenoma (... -1.600 1.5e-02
intraductal papillary-mucinous neoplasm ... -1.800 3.4e-02
lung adenocarcinoma 1.200 5.0e-03
lung carcinoma 1.700 9.4e-06
nephrosclerosis -2.081 3.6e-02
pancreatic cancer -2.900 2.1e-03
primary pancreatic ductal adenocarcinoma -2.697 1.3e-03
psoriasis -1.100 1.1e-03

Gene RIF (63)

AA Sequence

MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQP      1 - 70
MGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGRFGCEIENNRSSGAFWKYYYD     71 - 140
GKDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKAYLEEECPATLRKYLKYSKNILDRQDPPSVV    141 - 210
VTSHQAPGEKKKLKCLAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSC    211 - 280
HVQHSSLAQPLVVPWEAS                                                        281 - 298
//

Text Mined References (108)

PMID Year Title