Property Summary

NCBI Gene PubMed Count 94
Grant Count 15
Funding $1,332,508.08
PubMed Score 164.12
PubTator Score 192.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
nephrosclerosis -2.081 0.036
psoriasis -1.100 0.001
ependymoma 1.300 0.018
glioblastoma 1.900 0.001
ulcerative colitis 2.900 0.000
primary pancreatic ductal adenocarcinoma -2.697 0.001
intraductal papillary-mucinous adenoma (... -1.600 0.015
intraductal papillary-mucinous neoplasm ... -1.800 0.034
fibroadenoma 2.700 0.012
interstitial cystitis -2.600 0.001
cystic fibrosis -3.100 0.000
lung adenocarcinoma 1.200 0.005
adult high grade glioma 1.900 0.001
pilocytic astrocytoma 4.500 0.000
lung carcinoma 1.700 0.000
Breast cancer -2.400 0.001
chronic rhinosinusitis 3.624 0.011
pancreatic cancer -2.900 0.002

Gene RIF (57)

PMID Text
26487699 It was concluded that the lipid-binding groove in ZA2G contains at least two distinct fatty acid-binding sites.
26383228 reduced AZGP1 expression is strongly related to adverse prostate cancer prognosis, independently of established clinic-pathological variables and PTEN deletions.
26068931 Zinc-alpha2-glycoprotein inhibits insulin-induced glucose uptake in human adipocytes by impairing insulin signaling at the level of AKT in a PP2A-dependent manner.
25788525 AZGP1 is a negative regulator of fibrosis progression in kidney and heart
25708842 Plasma ZAG was elevated in smokers, and correlated with male gender, smoking amount and duration, nicotine dependence, and metabolic syndrome.
25580089 we demonstrated a significant increase in ZAG in critically ill patients temporally related to recovery from sepsis
25561225 comprehensive evaluation of AZGP1 variation at the mRNA and protein level in colon cancer; study demonstrated that AZGP1 is a potential serum marker of colon cancer that may be correlated with tumorigenesis
25427682 Increased serum ZAG concentrations induced, at least partly, by Sp1 may cause an increase in vascular tone through the activation of RhoA
25076420 ZAG protein accumulates in plasma in ESRD and hemodialysis patients but this increase is not directly correlated to the decrease in GFR.
24918753 overexpression of AZGP1 suppressed the activation of the mTOR pathway and endogenous FASN-regulated fatty acid synthesis, mitigating the malignant phenotype of LoVo cells
More...

AA Sequence

MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQP      1 - 70
MGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGRFGCEIENNRSSGAFWKYYYD     71 - 140
GKDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKAYLEEECPATLRKYLKYSKNILDRQDPPSVV    141 - 210
VTSHQAPGEKKKLKCLAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSC    211 - 280
HVQHSSLAQPLVVPWEAS                                                        281 - 298
//

Text Mined References (100)

PMID Year Title
26487699 2016 Zinc-induced oligomerization of zinc ?2 glycoprotein reveals multiple fatty acid-binding sites.
26383228 2016 Reduced AZGP1 expression is an independent predictor of early PSA recurrence and associated with ERG-fusion positive and PTEN deleted prostate cancers.
26068931 2015 Zinc-?2-Glycoprotein Modulates AKT-Dependent Insulin Signaling in Human Adipocytes by Activation of the PP2A Phosphatase.
25788525 2015 Zinc-?2-Glycoprotein Exerts Antifibrotic Effects in Kidney and Heart.
25708842 2015 Plasma zinc ?2-glycoprotein levels are elevated in smokers and correlated with metabolic syndrome.
25580089 2014 Circulating anti-inflammatory adipokines High Molecular Weight Adiponectin and Zinc-?2-glycoprotein (ZAG) are inhibited in early sepsis, but increase with clinical recovery: a pilot study.
25561225 2014 Zinc-?-2-glycoprotein: a candidate biomarker for colon cancer diagnosis in Chinese population.
25427682 2015 Significance of serum Zn-?2-glycoprotein for the regulation of blood pressure.
25076420 2014 The relationship between renal function and plasma concentration of the cachectic factor zinc-alpha2-glycoprotein (ZAG) in adult patients with chronic kidney disease.
24918753 2014 Alpha-2-glycoprotein 1(AZGP1) regulates biological behaviors of LoVo cells by down-regulating mTOR signaling pathway and endogenous fatty acid synthesis.
More...