Property Summary

NCBI Gene PubMed Count 103
Grant Count 85
R01 Count 45
Funding $13,744,201.51
PubMed Score 286.08
PubTator Score 221.02

Knowledge Summary

Patent (28,058)

Expression

  Differential Expression (10)

Disease log2 FC p
hepatocellular carcinoma 1.700 0.000
non-small cell lung carcinoma -1.800 0.000
lung cancer -3.200 0.000
colon cancer 1.500 0.023
Multiple Sclerosis 1.200 0.001
lung adenocarcinoma -1.500 0.000
lung carcinoma -2.700 0.000
mucosa-associated lymphoid tissue lympho... 2.169 0.010
ulcerative colitis 1.700 0.014
psoriasis 2.700 0.000

Synonym

Accession P25090 A8K3E2
Symbols ALXR
HM63
FMLPX
FPR2A
FPRH1
FPRH2
FPRL1
LXA4R
FMLP-R-II

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
441 screening 72 / 16 / 24216 Primary HTS Assay for Formylpeptide Receptor-Like-1 (FPRL1) Ligands and Primary HTS Counter-Screen Assay for Formylpeptide Receptor (FPR) Ligands
520 confirmatory 6 / 0 / 266 Dose Response Assay for Formylpeptide Receptor-Like-1 (FPRL1) Ligands and Dose Response Counter-Screen Assay for Formylpeptide Receptor (FPR) Ligands
698 screening 3 / 0 / 4 Secondary Calcium Response Assay for Formylpeptide Receptor-Like-1 (FPRL1) Antagonists
723 confirmatory 0 / 0 / 58 Formylpeptide Receptor (FPR) Ligand Structure Activity Relationship (SAR) Analysis : Dose Response Assay Counterscreen Against Formyl Peptide Receptor-Like-1 (FPRL1)
725 screening 1 / 0 / 1275 Formylpeptide Receptor (FPR) Ligand Structure Activity Relationship (SAR) Analysis : Primary HTS Assay Counterscreen Against Formyl Peptide Receptor-Like-1 (FPRL1)
765 screening 13 / 0 / 157 Formylpeptide Receptor-Like-1 (FPRL1) Ligand Structure Activity Relationship (SAR) Analysis : Primary HTS Assay
766 confirmatory 5 / 0 / 10 Formylpeptide Receptor (FPRL1) Ligand Structure Activity Relationship (SAR) Analysis : Dose Response Assay
1061 screening 3 / 0 / 3 Formylpeptide Receptor-Like-1(FPRL1) Structure Activity Relationship (SAR) Analysis: Secondary Calcium Response Assay for Antagonists
1202 summary 6 / 0 / 0 Assay for Formylpeptide Receptor Family Ligands: Target Formylpeptide Receptor-Like-1

Gene RIF (93)

PMID Text
26996596 Data show that the purinergic receptor P2Y2 (P2Y2R) pepducin activates neutrophils through formyl peptide receptor 2 (FPR2), and ATP is turned into an activating agonist through a receptor cross-talk mechanism that involves both FPR2 and P2Y2R.
26803520 We conclude that ANX-A1 is an important regulator of mast cell reactivity to compound 48/80 exerting a negative feedback effect through a mechanism that depends at least partly on the FPR receptor
26565966 Lipoxin A4 may have a role in preventing metabolic syndrome in a middle-aged Chinese population
26297794 Serum amyloid A1alpha induces paracrine IL-8/CXCL8 via TLR2 and directly synergizes with this chemokine via CXCR2 and formyl peptide receptor 2 to recruit neutrophils.
26248046 pro-inflammatory stimuli lead to FPR2/ALX expression while LXA4 induces an anti-inflammatory response
26071379 a pepducin designed to target FPR1 was found to hijack FPR2 and potently inhibit neutrophil functions
25864260 There was an excessive maternal inflammatory response in preeclampsia. LXA4, ALX-R, and NF-kappaB p65 may be involved in the disease process ofpreeclampsia.
25490767 ANXA1 may contribute to the regulation of tumor growth and metastasis through paracrine mechanisms that are mediated by FPR2/ALX
25462815 A stable peptidomimetic inhibited the activation of human neutrophils via direct interaction with FPR2.
25341894 Expression of FPR2/ALX was analysed in 127 carotid atherosclerotic lesions and revealed that this receptor was expressed on macrophages, smooth muscle cells, and endothelial cells.
More...

AA Sequence

METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALA      1 - 70
DFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVS     71 - 140
LAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGF    141 - 210
SLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKII    211 - 280
DILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQA    281 - 350
M//

Text Mined References (104)

PMID Year Title
26996596 2016 A pepducin designed to modulate P2Y2R function interacts with FPR2 in human neutrophils and transfers ATP to an NADPH-oxidase-activating ligand through a receptor cross-talk mechanism.
26803520 2016 The role of the Annexin-A1/FPR2 system in the regulation of mast cell degranulation provoked by compound 48/80 and in the inhibitory action of nedocromil.
26565966 2015 Inverse Relationship between Serum Lipoxin A4 Level and the Risk of Metabolic Syndrome in a Middle-Aged Chinese Population.
26297794 2015 Serum amyloid A1? induces paracrine IL-8/CXCL8 via TLR2 and directly synergizes with this chemokine via CXCR2 and formyl peptide receptor 2 to recruit neutrophils.
26248046 2015 Differential regulation of monocytic expression of leukotriene and lipoxin receptors.
26071379 2015 A neutrophil inhibitory pepducin derived from FPR1 expected to target FPR1 signaling hijacks the closely related FPR2 instead.
25864260 2014 Expression of anti-inflammatory mediator lipoxin A4 and inflammation responsive transcriptive factors NF-kappa B in patients with preeclampsia.
25490767 2014 Inflammation and cancer: role of annexin A1 and FPR2/ALX in proliferation and metastasis in human laryngeal squamous cell carcinoma.
25462815 2015 The proteolytically stable peptidomimetic Pam-(Lys-?NSpe)6-NH2 selectively inhibits human neutrophil activation via formyl peptide receptor 2.
25341894 2015 The role of the FPR2/ALX receptor in atherosclerosis development and plaque stability.
More...