Property Summary

Ligand Count 11
NCBI Gene PubMed Count 113
PubMed Score 330.93
PubTator Score 221.02

Knowledge Summary

Patent (28,058)

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
colon cancer 1.500 2.3e-02
hepatocellular carcinoma 1.700 2.3e-04
lung adenocarcinoma -1.500 1.6e-10
lung cancer -2.600 4.7e-03
lung carcinoma -2.700 1.1e-16
mucosa-associated lymphoid tissue lympho... 2.169 1.0e-02
Multiple Sclerosis 1.200 9.9e-04
non-small cell lung cancer -1.622 1.5e-14
psoriasis 2.700 7.6e-39
ulcerative colitis 1.700 1.4e-02

 GWAS Trait (1)

Gene RIF (97)

AA Sequence

METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALA      1 - 70
DFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVS     71 - 140
LAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGF    141 - 210
SLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKII    211 - 280
DILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQA    281 - 350
M//

Text Mined References (114)

PMID Year Title