Property Summary

NCBI Gene PubMed Count 43
PubMed Score 123.72
PubTator Score 57.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
juvenile dermatomyositis 1189 7.62168377321193E-11
acute quadriplegic myopathy 1157 9.4688554832142E-6
ovarian cancer 8492 0.00289780978809056
primary pancreatic ductal adenocarcinoma 1271 0.0152080517347657
spina bifida 1064 0.0412572915265152
Disease Target Count Z-score Confidence
Cancer 2346 3.089 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
juvenile dermatomyositis 1.199 0.000
acute quadriplegic myopathy 1.136 0.000
primary pancreatic ductal adenocarcinoma -1.042 0.015
spina bifida -1.402 0.041
ovarian cancer -1.200 0.003

Synonym

Accession P24863 B4DPZ1 Q9H543
Symbols CycC

Gene

PDB

3RGF   4CRL   4F6S   4F6U   4F6W   4F70   4F7J   4F7L   4F7N   4F7S   4G6L   5BNJ   5CEI   5FGK   5HBE   5HBH   5HBJ   5HNB   5HVY   5I5Z  

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (15)

PMID Text
26042770 our results suggest that mTORC1 activation in NAFLD and insulin resistance results in down-regulation of the CDK8-CycC complex and elevation of lipogenic protein expression.
25986860 results suggest that CCNC temporarily protects SRC-2 against degradation and this event is involved in the transcriptional regulation of SRC-2 cell cycle target genes.
25344755 cyclin-C-CDK complexes phosphorylate the Notch1 intracellular domain (ICN1) and promote ICN1 degradation
24754906 Cancer-mediated CDK8 point mutations (D173A and D189N) change the binding pattern of cdk8 to its partner, CycC.
23630251 analysis of the structure-kinetic relationship of the cyclin-dependent kinase 8 (CDK8)/cyclin C (CycC) complex
22024040 Silencing beta-catenin gene may induce changes of cell cycle and in cyclin B1 and cyclin C protein expression.
21806996 2.2-A crystal structure of CDK8/CycC in complex with sorafenib; CDK8 structure reveals a unique CycC recognition helix that explains the specificity of the CDK8/CycC pair and discrimination among the highly promiscuous binding in the CDK/cyclin family
19967789 Studies establish cyclin C as a critical regulator of the G(0)/G(1) transition of human HSPCs and suggest that modulating cyclin C levels may be useful for HSC expansion and more efficient engraftment.
19683536 Data suggests that the primary regulation of Cyclin C by all-trans RA and Forskolin mediates some of the cell cycle control actions of these compounds.
17385550 C2 isoform may play a presently unexplored and important role in mammalian testis and probably this isoform is the one that is mainly implicated in cell cycle regulation.
More...

AA Sequence

MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFK      1 - 70
RFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEF     71 - 140
YLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQ    141 - 210
KDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSY    211 - 280
SQS                                                                       281 - 283
//

Text Mined References (48)

PMID Year Title
26042770 2015 mTORC1 Down-Regulates Cyclin-Dependent Kinase 8 (CDK8) and Cyclin C (CycC).
25986860 2015 Cyclin C interacts with steroid receptor coactivator 2 and upregulates cell cycle genes in MCF-7 cells.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25416956 2014 A proteome-scale map of the human interactome network.
25344755 2014 Cyclin C is a haploinsufficient tumour suppressor.
24754906 2014 All-atomic molecular dynamic studies of human CDK8: insight into the A-loop, point mutations and binding with its partner CycC.
23746844 2013 HIF1A employs CDK8-mediator to stimulate RNAPII elongation in response to hypoxia.
23630251 2013 Structure-kinetic relationship study of CDK8/CycC specific compounds.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
22024040 The effect of cell cycle and expression of cyclin B1 and cyclin C protein in hepatocellular carcinoma cell line HepG2 and SMMC-7721 after of silencing ?-catenin gene.
More...