Property Summary

NCBI Gene PubMed Count 45
PubMed Score 131.12
PubTator Score 57.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy 1.136 9.5e-06
juvenile dermatomyositis 1.199 7.6e-11
ovarian cancer -1.200 2.9e-03
primary pancreatic ductal adenocarcinoma -1.042 1.5e-02
spina bifida -1.402 4.1e-02

Gene RIF (15)

AA Sequence

MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFK      1 - 70
RFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEF     71 - 140
YLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQ    141 - 210
KDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSY    211 - 280
SQS                                                                       281 - 283
//

Text Mined References (50)

PMID Year Title