Property Summary

NCBI Gene PubMed Count 43
Grant Count 34
R01 Count 22
Funding $2,133,686.51
PubMed Score 123.72
PubTator Score 57.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
juvenile dermatomyositis 1.199 0.000
acute quadriplegic myopathy 1.136 0.000
primary pancreatic ductal adenocarcinoma -1.042 0.015
spina bifida -1.402 0.041
ovarian cancer -1.200 0.003

Gene RIF (15)

PMID Text
26042770 our results suggest that mTORC1 activation in NAFLD and insulin resistance results in down-regulation of the CDK8-CycC complex and elevation of lipogenic protein expression.
25986860 results suggest that CCNC temporarily protects SRC-2 against degradation and this event is involved in the transcriptional regulation of SRC-2 cell cycle target genes.
25344755 cyclin-C-CDK complexes phosphorylate the Notch1 intracellular domain (ICN1) and promote ICN1 degradation
24754906 Cancer-mediated CDK8 point mutations (D173A and D189N) change the binding pattern of cdk8 to its partner, CycC.
23630251 analysis of the structure-kinetic relationship of the cyclin-dependent kinase 8 (CDK8)/cyclin C (CycC) complex
22024040 Silencing beta-catenin gene may induce changes of cell cycle and in cyclin B1 and cyclin C protein expression.
21806996 2.2-A crystal structure of CDK8/CycC in complex with sorafenib; CDK8 structure reveals a unique CycC recognition helix that explains the specificity of the CDK8/CycC pair and discrimination among the highly promiscuous binding in the CDK/cyclin family
19967789 Studies establish cyclin C as a critical regulator of the G(0)/G(1) transition of human HSPCs and suggest that modulating cyclin C levels may be useful for HSC expansion and more efficient engraftment.
19683536 Data suggests that the primary regulation of Cyclin C by all-trans RA and Forskolin mediates some of the cell cycle control actions of these compounds.
17385550 C2 isoform may play a presently unexplored and important role in mammalian testis and probably this isoform is the one that is mainly implicated in cell cycle regulation.
More...

AA Sequence

MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFK      1 - 70
RFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEF     71 - 140
YLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQ    141 - 210
KDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSY    211 - 280
SQS                                                                       281 - 283
//

Text Mined References (48)

PMID Year Title
26042770 2015 mTORC1 Down-Regulates Cyclin-Dependent Kinase 8 (CDK8) and Cyclin C (CycC).
25986860 2015 Cyclin C interacts with steroid receptor coactivator 2 and upregulates cell cycle genes in MCF-7 cells.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25416956 2014 A proteome-scale map of the human interactome network.
25344755 2014 Cyclin C is a haploinsufficient tumour suppressor.
24754906 2014 All-atomic molecular dynamic studies of human CDK8: insight into the A-loop, point mutations and binding with its partner CycC.
23746844 2013 HIF1A employs CDK8-mediator to stimulate RNAPII elongation in response to hypoxia.
23630251 2013 Structure-kinetic relationship study of CDK8/CycC specific compounds.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
22024040 The effect of cell cycle and expression of cyclin B1 and cyclin C protein in hepatocellular carcinoma cell line HepG2 and SMMC-7721 after of silencing ?-catenin gene.
More...