Property Summary

Ligand Count 4
NCBI Gene PubMed Count 66
PubMed Score 515.66
PubTator Score 152.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer 2.800 1.0e-14
breast carcinoma 2.700 1.3e-04
ductal carcinoma in situ 2.200 5.6e-04
group 3 medulloblastoma 1.200 5.4e-03
invasive ductal carcinoma 4.053 1.1e-06
lung adenocarcinoma 1.500 1.4e-07
non-small cell lung cancer 1.558 3.7e-11
osteosarcoma 1.313 4.5e-03
ovarian cancer 1.900 2.0e-02
pancreatic cancer 2.300 1.7e-05
primary pancreatic ductal adenocarcinoma 1.828 3.2e-02

Gene RIF (57)

AA Sequence

MAPAAWLRSAAARALLPPMLLLLLQPPPLLARALPPDAHHLHAERRGPQPWHAALPSSPAPAPATQEAPR      1 - 70
PASSLRPPRCGVPDPSDGLSARNRQKRFVLSGGRWEKTDLTYRILRFPWQLVQEQVRQTMAEALKVWSDV     71 - 140
TPLTFTEVHEGRADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTHREGDVHFDYDETWTIGDDQGTDLL    141 - 210
QVAAHEFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTN    211 - 280
EIAPLEPDAPPDACEASFDAVSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQGLPSPVDAAFEDA    281 - 350
QGHIWFFQGAQYWVYDGEKPVLGPAPLTELGLVRFPVHAALVWGPEKNKIYFFRGRDYWRFHPSTRRVDS    351 - 420
PVPRRATDWRGVPSEIDAAFQDADGYAYFLRGRLYWKFDPVKVKALEGFPRLVGPDFFGCAEPANTFL      421 - 488
//

Text Mined References (68)

PMID Year Title