Property Summary

NCBI Gene PubMed Count 61
Grant Count 32
R01 Count 18
Funding $2,981,397.39
PubMed Score 504.61
PubTator Score 152.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (52)

PMID Text
26956825 Matrix metalloproteinase 11 has a role in degenerating intervertebral disc disease
26507719 results indicated that both CD147 and MMP-11 may be involved in the progression of colorectal cancer, and they are potential prognostic factors and might become new therapeutic targets for CRC patients
26084486 Our findings identified these 2 genes as a novel breast cancer biomarker gene set, which may facilitate the diagnosis and treatment in breast cancer clinical therapies.
25987024 High Expression of Matrix Metalloproteinase-11 is associated with Cholangiocarcinoma.
25423087 study showed that plasma level of MMP-11 may be useful for assessment of the disease progression, especially lymph node metastasis, in patients with OSCC
25081520 MMP-14 function might represent one critical regulatory mechanism to control the extent of pericellular MMP-11 bioavailability and protect cells from excessive/inappropriate MMP-11 function.
24838924 combined effects of the MMP-11 gene polymorphisms and environmental carcinogens are related to an increased risk for the development of OSCC and may be a predictive factor for tumor lymph node metastasis in Taiwanese with OSCC
24564996 These findings further suggest MMP11 as a promising biomarker for breast and prostate cabcer.
23755751 Knockdown of MMP11 expression could inhibit the proliferation and invasion of gastric adenocarcinoma cells probably through down-regulation of the IGF-1 signaling pathway.
23211491 Findings define a regulatory role of miR-98 in tumor angiogenesis and invasion through repressed ALK4 and MMP11 expression.
More...

AA Sequence

MAPAAWLRSAAARALLPPMLLLLLQPPPLLARALPPDAHHLHAERRGPQPWHAALPSSPAPAPATQEAPR      1 - 70
PASSLRPPRCGVPDPSDGLSARNRQKRFVLSGGRWEKTDLTYRILRFPWQLVQEQVRQTMAEALKVWSDV     71 - 140
TPLTFTEVHEGRADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTHREGDVHFDYDETWTIGDDQGTDLL    141 - 210
QVAAHEFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTN    211 - 280
EIAPLEPDAPPDACEASFDAVSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQGLPSPVDAAFEDA    281 - 350
QGHIWFFQGAQYWVYDGEKPVLGPAPLTELGLVRFPVHAALVWGPEKNKIYFFRGRDYWRFHPSTRRVDS    351 - 420
PVPRRATDWRGVPSEIDAAFQDADGYAYFLRGRLYWKFDPVKVKALEGFPRLVGPDFFGCAEPANTFL      421 - 488
//

Text Mined References (63)

PMID Year Title
26956825 2016 Evaluation of the Association Between Matrix Metalloproteinase 11 and Intervertebral Disc Disease.
26507719 2015 Expression of CD147 and matrix metalloproteinase-11 in colorectal cancer and their relationship to clinicopathological features.
26084486 2015 Gene expression profiling leads to discovery of correlation of matrix metalloproteinase 11 and heparanase 2 in breast cancer progression.
25987024 2015 High Expression of Matrix Metalloproteinase-11 indicates Poor Prognosis in Human Cholangiocarcinoma.
25423087 2014 High level of plasma matrix metalloproteinase-11 is associated with clinicopathological characteristics in patients with oral squamous cell carcinoma.
25081520 2014 Functional relationship between matrix metalloproteinase-11 and matrix metalloproteinase-14.
24838924 2015 Association of matrix metalloproteinase-11 polymorphisms with susceptibility and clinicopathologic characteristics for oral squamous cell carcinoma.
24564996 2014 Circulating MMP11 and specific antibody immune response in breast and prostate cancer patients.
23755751 Knockdown of MMP11 inhibits proliferation and invasion of gastric cancer cells.
23211491 2012 MicroRNA miR-98 inhibits tumor angiogenesis and invasion by targeting activin receptor-like kinase-4 and matrix metalloproteinase-11.
More...