Property Summary

NCBI Gene PubMed Count 23
PubMed Score 25.78
PubTator Score 28.95

Knowledge Summary

Patent (625)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -2.000 0.000
posterior fossa group B ependymoma -2.700 0.000
oligodendroglioma -1.900 0.000
glioblastoma -2.500 0.000
medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -3.400 0.000
primitive neuroectodermal tumor -2.600 0.000
adult high grade glioma -2.500 0.002
pilocytic astrocytoma -2.900 0.000
lung adenocarcinoma 3.100 0.000
ulcerative colitis -1.500 0.000

Synonym

Accession P23677 Q8TAN3
Symbols IP3KA
IP3-3KA

Gene

PANTHER Protein Class (2)

PDB

4UPU   1W2C   1W2D   1W2F  

 Collection (1)

Gene RIF (9)

PMID Text
26249031 Our data indicated that ITPKA expression was significantly up-regulated in hepatocellular carcinoma and could serve as a potential novel prognostic biomarker
25101901 describe the crystal structure of the complex between human Ca2+/CaM and the CaM-binding region of human IP3-3K isoform A (residues 158-183)
21792881 we conclude that the observed expression of ITPKA early in tumor development increases the metastatic potential of lung adenocarcinoma cells.
20022963 Inositol 1,4,5-trisphosphate 3-kinase-A is a new cell motility-promoting protein that increases the metastatic potential of tumor cells by two functional activities.
18498254 the morphological changes induced by IP3K-A are mediated by non-enzymatic activities of the protein.
18187620 Knockdown of inositol-trisphosphate 3-kinase A (ITPKA) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16525636 Data suggest that ITPKA may be related to carcinogenesis by the modulation of inositol polyphosphates and Ca2+ homeostasis and that ITPKA may be a potential novel molecular target and biomarker.
15350214 We report the structure of an IPK, the human Ins(1,4,5)P3 3-kinase-A, both free and in complexes with substrates and products.
12747803 results highlight the potential role of the three isoforms of InsP3 3-kinase as direct InsP3 metabolizing enzymes and direct regulators of Ca2+ responses to extracellular signals

AA Sequence

MTLPGGPTGMARPGGARPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAKRRGGQVPNGL      1 - 70
PRAPPAPVIPQLTVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRLSTSSVSSTGSSSLLEDSEDD     71 - 140
LLSDSESRSRGNVQLEAGEDVGQKNHWQKIRTMVNLPVISPFKKRYAWVQLAGHTGSFKAAGTSGLILKR    141 - 210
CSEPERYCLARLMADALRGCVPAFHGVVERDGESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARE    211 - 280
RPKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTR    281 - 350
SREQVLRVFEEFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKT    351 - 420
TPLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER                                 421 - 461
//

Text Mined References (24)

PMID Year Title
26249031 2015 ITPKA expression is a novel prognostic factor in hepatocellular carcinoma.
25101901 2014 A new calmodulin-binding motif for inositol 1,4,5-trisphosphate 3-kinase regulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21792881 2011 Functional role of inositol-1,4,5-trisphosphate-3-kinase-A for motility of malignant transformed cells.
20022963 2010 Inositol 1,4,5-trisphosphate 3-kinase-A is a new cell motility-promoting protein that increases the metastatic potential of tumor cells by two functional activities.
18498254 2008 Ins(1,4,5)P3 3-kinase-A overexpression induces cytoskeletal reorganization via a kinase-independent mechanism.
16525636 2006 Down-regulation of 1D-myo-inositol 1,4,5-trisphosphate 3-kinase A protein expression in oral squamous cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15350214 2004 Structure of a human inositol 1,4,5-trisphosphate 3-kinase: substrate binding reveals why it is not a phosphoinositide 3-kinase.
More...