Property Summary

NCBI Gene PubMed Count 1,565
PubMed Score 9826.70
PubTator Score 5694.87

Knowledge Summary


No data available


  Disease Sources (6)

Disease Target Count P-value
astrocytoma 1493 2.36080123314612E-30
lung adenocarcinoma 2714 1.2619525602027E-18
posterior fossa group B ependymoma 1530 8.78188975802721E-14
malignant mesothelioma 3163 2.44108837710389E-8
glioblastoma 5572 3.58218127690671E-7
pituitary cancer 1972 1.19811830308079E-6
pediatric high grade glioma 2712 2.79749808126172E-6
lung cancer 4473 8.29565233443949E-6
group 4 medulloblastoma 1875 1.37459589510538E-5
pilocytic astrocytoma 3086 6.25955397171635E-5
ovarian cancer 8492 0.00102787898890019
interstitial lung disease 292 0.00166872728136643
primitive neuroectodermal tumor 3031 0.00172397962918863
atypical teratoid/rhabdoid tumor 1095 0.0022762991016289
oligodendroglioma 2849 0.00398761490607993
medulloblastoma, large-cell 6234 0.00514238355340192
interstitial cystitis 2299 0.0248489485306343
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
substance-related disorder 105 0.0 2.0
Disease Target Count
Bulimia nervosa 2 1


  Differential Expression (17)

Disease log2 FC p
interstitial lung disease -1.600 0.002
malignant mesothelioma -2.700 0.000
posterior fossa group B ependymoma -3.100 0.000
oligodendroglioma -2.300 0.004
astrocytoma -1.900 0.000
glioblastoma -2.400 0.000
group 4 medulloblastoma -3.000 0.000
atypical teratoid/rhabdoid tumor -1.700 0.002
medulloblastoma, large-cell -2.300 0.005
primitive neuroectodermal tumor -2.300 0.002
lung cancer 3.100 0.000
interstitial cystitis 1.100 0.025
lung adenocarcinoma -1.100 0.000
pediatric high grade glioma -2.500 0.000
pilocytic astrocytoma -2.100 0.000
ovarian cancer -1.200 0.001
pituitary cancer -2.100 0.000




1B8M   1BND  

  Ortholog (12)

 CSPA Cell Line (1)

Gene RIF (1786)

27263272 Current review is dedicated to key aspects of proBDNF expression, its proteolysis to mBDNF, and its function in developing nervous system, long-term synaptic plasticity and extinction and possible involvement in pathologies of nervous system.
27085775 Data suggest that BDNF protects pancreatic beta-cells from apoptotic effects of certain toxic agents [alloxan, streptozotocin, doxorubicin and benzo(a)pyrene].
27008247 Major depression patients had higher serum BDNF than controls. BDNF was correlated with severity and duration of major depression.
27006395 These findings suggest that alterations of BDNF levels in human serum as reported in studies dealing with depression or physical exercise may primarily reflect changes occurring in megakaryocytes and platelets, including the ability of the latter to retain and release BDNF.
26980363 Older adults after a physical activity intervention showed the greatest decreases in somatic symptoms of Depression with a preferential benefit in male carriers of the BDNF Met allele.
26976342 results suggest that BDNF promoter methylation is associated with drug addiction, although further studies are needed to understand the mechanisms by which BDNF promoter methylation contributes to the pathophysiology of drug addiction
26976307 Expression of brain-derived neurotrophic factor (BDNF) and the serotonin transporter (5-HTT)have been linked with major depressive disorder.
26921055 The gene-environment combination of PRKCG rs3745406 C allele, BDNF rs6265 G allele and high level of negative life events was significantly associated with major depressive disorder.
26901829 Results represent the first evidence suggesting a link between the BDNF gene and self-reported empathy and warrant further studies of this polymorphism due to its potential clinical significance.
26892514 This analysis indicated a close correlation between plasma BDNF levels and insulin effectiveness in heart failure

AA Sequence

TQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR                                     211 - 247

Text Mined References (1566)

PMID Year Title
27263272 [Diversity of proBDNF and mBDNF functions in the central nervous system].
27085775 2016 BDNF protects pancreatic ? cells (RIN5F) against cytotoxic action of alloxan, streptozotocin, doxorubicin and benzo(a)pyrene in vitro.
27008247 2016 Elevated Brain-Derived Neurotrophic Factor Correlates Negatively with Severity and Duration of Major Depressive Episodes.
27006395 2016 Brain-derived Neurotrophic Factor in Megakaryocytes.
26980363 2016 Genetic Moderators of the Impact of Physical Activity on Depressive Symptoms.
26976342 2016 A significant association between BDNF promoter methylation and the risk of drug addiction.
26976307 2016 The influence of 5-HTTLPR and Val66Met polymorphisms on cortical thickness and volume in limbic and paralimbic regions in depression: a preliminary study.
26921055 2016 The interaction of combined effects of the BDNF and PRKCG genes and negative life events in major depressive disorder.
26901829 2016 BDNF Val66Met Polymorphism Is Associated with Self-Reported Empathy.
26892514 2016 The impact of an inverse correlation between plasma B-type natriuretic peptide levels and insulin resistance on the diabetic condition in patients with heart failure.