Property Summary

NCBI Gene PubMed Count 19
PubMed Score 0.81
PubTator Score 13.51

Knowledge Summary

Patent

No data available

Synonym

Accession P23527 Q3KPI7 Q8TCV6
Symbols H2B.2
H2B/n
H2BFN
dJ193B12.2

Gene

Gene RIF (4)

PMID Text
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Text Mined References (22)

PMID Year Title
23824326 2013 USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16713563 2006 Histone H2B monoubiquitination functions cooperatively with FACT to regulate elongation by RNA polymerase II.
16627869 2006 Quantitative proteomic analysis of post-translational modifications of human histones.
16319397 2006 Characterization of histone H2A and H2B variants and their post-translational modifications by mass spectrometry.
16307923 2005 Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation.
16283522 2005 Inhibition of core histones acetylation by carcinogenic nickel(II).
More...