Property Summary

NCBI Gene PubMed Count 48
Grant Count 53
R01 Count 13
Funding $10,701,849.16
PubMed Score 974.29
PubTator Score 649.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession P23381 A6NGN1 A6NID3 P78535 Q502Y0 Q53XB6 Q9UDI5 Q9UDL3
Symbols IFI53
IFP53
GAMMA-2

Gene

PANTHER Protein Class (2)

PDB

1O5T   1R6T   1R6U   1ULH   2AKE   2AZX   2DR2   2QUH   2QUI   2QUJ   2QUK  

Gene RIF (27)

PMID Text
26209610 Overexpression of WARS predicts no recurrence and good survival for triple-negative breast cancer patients.
24515434 Tryptophanyl-tRNA synthetase expression is up-regulated in patients with rheumatoid arthritis.
23670221 Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14)
23651343 Indoleamine2,3-dioxygenase and tryptophanyl-tRNA synthetase may play critical roles in the immune pathogenesis of chronic kidney disease.
21926542 Tryptophanyl-tRNA synthetase down-regulation by hypoxia may be a factor responsible for low TrpRS in pancreatic tumors with high metastatic ability.
21442253 Naturally occurring fragments of the two proteins involved in translation, TyrRS and TrpRS, have opposing activities on angiogenesis.
20963594 Mini-tryptophanyl-tRNA synthetase inhibited ischemic angiogenesis in rats.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19900940 Low tryptophanyl-tRNA synthetase is associated with recurrence in colorectal cancer.
More...

AA Sequence

MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPT      1 - 70
SNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSH     71 - 140
RDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQ    141 - 210
AYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISF    211 - 280
PAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKM    281 - 350
SASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY    351 - 420
TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ                       421 - 471
//

Text Mined References (60)

PMID Year Title
26209610 2015 Prediction of Recurrence and Survival for Triple-Negative Breast Cancer (TNBC) by a Protein Signature in Tissue Samples.
24515434 2015 Increased TTS expression in patients with rheumatoid arthritis.
23670221 2014 Fat depot-specific mRNA expression of novel loci associated with waist-hip ratio.
23651343 2013 Serum levels and activity of indoleamine2,3-dioxygenase and tryptophanyl-tRNA synthetase and their association with disease severity in patients with chronic kidney disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21926542 2011 Hypoxia signature of splice forms of tryptophanyl-tRNA synthetase marks pancreatic cancer cells with distinct metastatic abilities.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...