Tbio | Tryptophan--tRNA ligase, cytoplasmic |
Isoform 1, isoform 2 and T1-TrpRS have aminoacylation activity while T2-TrpRS lacks it. Isoform 2, T1-TrpRS and T2-TrpRS possess angiostatic activity whereas isoform 1 lacks it. T2-TrpRS inhibits fluid shear stress-activated responses of endothelial cells. Regulates ERK, Akt, and eNOS activation pathways that are associated with angiogenesis, cytoskeletal reorganization and shear stress-responsive gene expression.
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
juvenile dermatomyositis | 1189 | 7.77382051025332E-14 |
psoriasis | 6685 | 8.11592869939955E-8 |
ulcerative colitis | 2087 | 8.80687243274818E-8 |
ovarian cancer | 8492 | 3.03407133653313E-5 |
lung cancer | 4473 | 7.67194851894935E-5 |
sarcoidosis | 368 | 1.02874438226134E-4 |
interstitial cystitis | 2299 | 3.82052289827765E-4 |
inflammatory breast cancer | 404 | 0.00187519451553392 |
cutaneous lupus erythematosus | 1056 | 0.0029113292184591 |
active Crohn's disease | 918 | 0.00370739220573088 |
dermatomyositis | 967 | 0.0042465026679262 |
chronic lymphocytic leukemia | 244 | 0.0152212530674306 |
esophageal adenocarcinoma | 737 | 0.018385476472012 |
subependymal giant cell astrocytoma | 2287 | 0.0188159148572224 |
MYELODYSPLASTIC SYNDROME | 39 | 0.0349915130366117 |
head and neck cancer and chronic obstructive pulmonary disease | 237 | 0.046519528736054 |
glioblastoma | 5572 | 0.0492663625289103 |
Disease | log2 FC | p |
---|---|---|
chronic lymphocytic leukemia | 1.562 | 0.015 |
esophageal adenocarcinoma | 1.500 | 0.018 |
cutaneous lupus erythematosus | 1.900 | 0.003 |
glioblastoma | 1.600 | 0.049 |
juvenile dermatomyositis | 1.881 | 0.000 |
lung cancer | -1.600 | 0.000 |
active Crohn's disease | 2.322 | 0.004 |
ulcerative colitis | 3.200 | 0.000 |
interstitial cystitis | 2.300 | 0.000 |
sarcoidosis | 1.100 | 0.000 |
subependymal giant cell astrocytoma | 1.946 | 0.019 |
MYELODYSPLASTIC SYNDROME | -1.100 | 0.035 |
psoriasis | 1.200 | 0.000 |
inflammatory breast cancer | 1.100 | 0.002 |
ovarian cancer | 2.100 | 0.000 |
dermatomyositis | 1.700 | 0.004 |
head and neck cancer and chronic obstruc... | 1.400 | 0.047 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
C. elegans | OMA EggNOG Inparanoid |
S.cerevisiae | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26209610 | Overexpression of WARS predicts no recurrence and good survival for triple-negative breast cancer patients. |
24515434 | Tryptophanyl-tRNA synthetase expression is up-regulated in patients with rheumatoid arthritis. |
23670221 | Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14) |
23651343 | Indoleamine2,3-dioxygenase and tryptophanyl-tRNA synthetase may play critical roles in the immune pathogenesis of chronic kidney disease. |
21926542 | Tryptophanyl-tRNA synthetase down-regulation by hypoxia may be a factor responsible for low TrpRS in pancreatic tumors with high metastatic ability. |
21442253 | Naturally occurring fragments of the two proteins involved in translation, TyrRS and TrpRS, have opposing activities on angiogenesis. |
20963594 | Mini-tryptophanyl-tRNA synthetase inhibited ischemic angiogenesis in rats. |
20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) |
19913121 | Observational study of gene-disease association. (HuGE Navigator) |
19900940 | Low tryptophanyl-tRNA synthetase is associated with recurrence in colorectal cancer. |
More... |
MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPT 1 - 70 SNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSH 71 - 140 RDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQ 141 - 210 AYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISF 211 - 280 PAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKM 281 - 350 SASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY 351 - 420 TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ 421 - 471 //
PMID | Year | Title |
---|---|---|
26209610 | 2015 | Prediction of Recurrence and Survival for Triple-Negative Breast Cancer (TNBC) by a Protein Signature in Tissue Samples. |
24515434 | 2015 | Increased TTS expression in patients with rheumatoid arthritis. |
23670221 | 2014 | Fat depot-specific mRNA expression of novel loci associated with waist-hip ratio. |
23651343 | 2013 | Serum levels and activity of indoleamine2,3-dioxygenase and tryptophanyl-tRNA synthetase and their association with disease severity in patients with chronic kidney disease. |
23533145 | 2013 | In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. |
22223895 | 2012 | Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features. |
21926542 | 2011 | Hypoxia signature of splice forms of tryptophanyl-tRNA synthetase marks pancreatic cancer cells with distinct metastatic abilities. |
21630459 | 2011 | Proteomic characterization of the human sperm nucleus. |
More... |