| Tbio | Tryptophan--tRNA ligase, cytoplasmic |
Isoform 1, isoform 2 and T1-TrpRS have aminoacylation activity while T2-TrpRS lacks it. Isoform 2, T1-TrpRS and T2-TrpRS possess angiostatic activity whereas isoform 1 lacks it. T2-TrpRS inhibits fluid shear stress-activated responses of endothelial cells. Regulates ERK, Akt, and eNOS activation pathways that are associated with angiogenesis, cytoskeletal reorganization and shear stress-responsive gene expression.
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Comments
Property Summary
| NCBI Gene PubMed Count | 48 |
| Grant Count | 53 |
| R01 Count | 13 |
| Funding | $10,701,849.16 |
| PubMed Score | 974.29 |
| PubTator Score | 649.79 |
| Disease | log2 FC | p |
|---|---|---|
| Chronic Lymphocytic Leukemia | 1.562 | 0.015 |
| esophageal adenocarcinoma | 1.500 | 0.018 |
| cutaneous lupus erythematosus | 1.900 | 0.003 |
| glioblastoma | 1.600 | 0.049 |
| juvenile dermatomyositis | 1.881 | 0.000 |
| lung cancer | -1.600 | 0.000 |
| active Crohn's disease | 2.322 | 0.004 |
| ulcerative colitis | 3.200 | 0.000 |
| interstitial cystitis | 2.300 | 0.000 |
| sarcoidosis | 1.100 | 0.000 |
| subependymal giant cell astrocytoma | 1.946 | 0.019 |
| MYELODYSPLASTIC SYNDROME | -1.100 | 0.035 |
| psoriasis | 1.200 | 0.000 |
| inflammatory breast cancer | 1.100 | 0.002 |
| ovarian cancer | 2.100 | 0.000 |
| dermatomyositis | 1.700 | 0.004 |
| head and neck cancer and chronic obstruc... | 1.400 | 0.047 |
| PMID | Text |
|---|---|
| 26209610 | Overexpression of WARS predicts no recurrence and good survival for triple-negative breast cancer patients. |
| 24515434 | Tryptophanyl-tRNA synthetase expression is up-regulated in patients with rheumatoid arthritis. |
| 23670221 | Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14) |
| 23651343 | Indoleamine2,3-dioxygenase and tryptophanyl-tRNA synthetase may play critical roles in the immune pathogenesis of chronic kidney disease. |
| 21926542 | Tryptophanyl-tRNA synthetase down-regulation by hypoxia may be a factor responsible for low TrpRS in pancreatic tumors with high metastatic ability. |
| 21442253 | Naturally occurring fragments of the two proteins involved in translation, TyrRS and TrpRS, have opposing activities on angiogenesis. |
| 20963594 | Mini-tryptophanyl-tRNA synthetase inhibited ischemic angiogenesis in rats. |
| 20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) |
| 19913121 | Observational study of gene-disease association. (HuGE Navigator) |
| 19900940 | Low tryptophanyl-tRNA synthetase is associated with recurrence in colorectal cancer. |
| More... |
MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPT 1 - 70 SNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSH 71 - 140 RDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQ 141 - 210 AYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISF 211 - 280 PAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKM 281 - 350 SASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDY 351 - 420 TSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ 421 - 471 //
| PMID | Year | Title |
|---|---|---|
| 26209610 | 2015 | Prediction of Recurrence and Survival for Triple-Negative Breast Cancer (TNBC) by a Protein Signature in Tissue Samples. |
| 24515434 | 2015 | Increased TTS expression in patients with rheumatoid arthritis. |
| 23670221 | 2014 | Fat depot-specific mRNA expression of novel loci associated with waist-hip ratio. |
| 23651343 | 2013 | Serum levels and activity of indoleamine2,3-dioxygenase and tryptophanyl-tRNA synthetase and their association with disease severity in patients with chronic kidney disease. |
| 23533145 | 2013 | In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine. |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
| 22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. |
| 22223895 | 2012 | Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features. |
| 21926542 | 2011 | Hypoxia signature of splice forms of tryptophanyl-tRNA synthetase marks pancreatic cancer cells with distinct metastatic abilities. |
| 21630459 | 2011 | Proteomic characterization of the human sperm nucleus. |
| More... |
