Property Summary

NCBI Gene PubMed Count 40
PubMed Score 406.79
PubTator Score 251.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.3e-05
Multiple myeloma 1332 5.8e-03
Waldenstrons macroglobulinemia 765 2.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cockayne syndrome 60 4.685 2.3

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.235 5.8e-03
ovarian cancer -1.500 1.3e-05
Waldenstrons macroglobulinemia 1.268 2.8e-02

Gene RIF (10)

AA Sequence

MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLI      1 - 70
KSWKKLLDGPSTEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSFPRAPSTSDSV     71 - 140
RLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNV    141 - 210
LCGNIPPDLFARMTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRS    211 - 280
ADEPMTTFVVCNECGNRWKFC                                                     281 - 301
//

Text Mined References (52)

PMID Year Title