Property Summary

NCBI Gene PubMed Count 38
Grant Count 12
R01 Count 5
Funding $1,344,806.75
PubMed Score 394.01
PubTator Score 251.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.268 0.028
Multiple myeloma 1.235 0.006
ovarian cancer 2.400 0.000

Gene RIF (10)

PMID Text
21596312 RNF20, presumably via H2Bub, selectively represses oncogenic genes by interfering with chromatin recruitment of TFIIS, a factor capable of relieving stalled RNA polymerase II. RNF20 inhibits the interaction between TFIIS and the PAF1 complex.
21070792 Results indicate that TFIIS is not limiting for the repair of transcription-blocking DNA lesions and thus the present work does not support a role for TFIIS in TC-NER.
20729154 a role for TFIIS in transcription recovery and re-establishment of the balance between hypo- and hyper-phosphorylated RNAPII after DNA damage repair
16736500 PLAG1 protein is overexpressed in epithelial, myoepithelial, and mesenchymal-like tumor cells in tumors with fusions to CHCHD7 and TCEA1.
16630816 Data shpw that SII is a major component of chromatin transcription and strongly synergizes with p300 (histone acetylation) at a step subsequent to preinitiation complex formation.
15351637 TFIIS has a role in suppression of transient pausing, which is the most important contribution of TFIIS to elongation from a stall position
14506279 transcription factor IIF, hepatitis delta antigen, and stimulatory factor II control human RNA polymerase II (RNAP II) pausing and transcript cleavage
12914699 Results provide a model of the RNA polymerase II-transcription elongation factor TFIIS complex from X-ray diffraction data to 3.8 A resolution.
9765201 TFIIS synergizes with HIV-1 Tat during transactivation of the HIV-1 LTR promoter
1559613 TFIIS synergizes with HIV-1 Tat during transactivation of the HIV-1 LTR promoter

AA Sequence

MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLI      1 - 70
KSWKKLLDGPSTEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSFPRAPSTSDSV     71 - 140
RLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNV    141 - 210
LCGNIPPDLFARMTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRS    211 - 280
ADEPMTTFVVCNECGNRWKFC                                                     281 - 301
//

Text Mined References (50)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21596312 2011 RNF20 inhibits TFIIS-facilitated transcriptional elongation to suppress pro-oncogenic gene expression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21127351 2011 Transcription factor IIS cooperates with the E3 ligase UBR5 to ubiquitinate the CDK9 subunit of the positive transcription elongation factor B.
21070792 2011 RNA interference against transcription elongation factor SII does not support its role in transcription-coupled nucleotide excision repair.
20729154 2010 Transcription factor IIS impacts UV-inhibited transcription.
More...