Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.76
PubTator Score 9.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
18976975 Knockdown of ecotropic viral integration site 2A (EVI2A) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MPTDMEHTGHYLHLAFLMTTVFSLSPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDY      1 - 70
KGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLI     71 - 140
IIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQ    141 - 210
STGVLTATRERKDEEGTEKLTNKQIG                                                211 - 236
//

Text Mined References (15)

PMID Year Title
25109740 2014 TAGLN expression is upregulated in NF1-associated malignant peripheral nerve sheath tumors by hypomethylation in its promoter and subpromoter regions.
17632510 2007 Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
2134734 1990 Type 1 neurofibromatosis gene: identification of a large transcript disrupted in three NF1 patients.
2117566 1990 Identification and characterization of transcripts from the neurofibromatosis 1 region: the sequence and genomic structure of EVI2 and mapping of other transcripts.
2117565 1990 The human homolog of murine Evi-2 lies between two von Recklinghausen neurofibromatosis translocations.
More...