Property Summary

Ligand Count 4
NCBI Gene PubMed Count 116
PubMed Score 389.83
PubTator Score 522.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
lung adenocarcinoma 2716 1.8e-12
psoriasis 6694 9.4e-11
osteosarcoma 7950 4.3e-05
ovarian cancer 8520 8.9e-04
esophageal adenocarcinoma 737 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 2.600 9.4e-11
esophageal adenocarcinoma -3.700 1.8e-02
lung adenocarcinoma -1.800 1.8e-12
osteosarcoma 1.128 4.3e-05
ovarian cancer -1.700 8.9e-04

Protein-protein Interaction (1)

Gene RIF (75)

AA Sequence

MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRG      1 - 70
RGSSSGTRRPGSRGSDSRRPVSRGSGVNAAGDGTIREGMLVVNGVDLLSSRSDQNRREHHTDEYEYDELI     71 - 140
VRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTHVIIPVGKGGSGGWKAQVVKASGQNLNLRVH    141 - 210
TSPNAIIGKFQFTVRTQSDAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTE    211 - 280
AQIGERTWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVNVSRVISAMVNSLDDNGVLIGNWSGDYSRGT    281 - 350
NPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDEN    351 - 420
MKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMKYD    421 - 490
TPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITYLYKHPEGSDAERKAVETA    491 - 560
AAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLINHSSSRRTVKLHLYLSVTFYTGVSGTIFK    561 - 630
ETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGA    631 - 700
AVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASL    701 - 770
DSPQLSQVHGVIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA                           771 - 817
//

Text Mined References (118)

PMID Year Title