Property Summary

NCBI Gene PubMed Count 22
Grant Count 13
R01 Count 12
Funding $1,999,411.17
PubMed Score 91.28
PubTator Score 42.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.796 0.000

Gene RIF (4)

PMID Text
26757249 These results suggested that the testis-specific linker histone, H1T, possesses a specific function to produce the chromatin architecture required for proper chromosome regulation, such as homologous recombination.
26362536 HIV-1 Gag interacts with HIST1H1T as demonstrated by proximity dependent biotinylation proteomics
24690621 HIV-1 Gag interacts with HIST1H1T as demonstrated by proximity dependent biotinylation proteomics
20587610 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMSLVALKKAL      1 - 70
AAAGYDVEKNNSRIKLSLKSLVNKGILVQTRGTGASGSFKLSKKVIPKSTRSKAKKSVSAKTKKLVLSRD     71 - 140
SKSPKTAKTNKRAKKPRATTPKTVRSGRKAKGAKGKQQQKSPVKARASKSKLTQHHEVNVRKATSKK       141 - 207
//

Text Mined References (22)

PMID Year Title
27018843 2016 Linker histone variant H1T targets rDNA repeats.
26757249 2016 Relaxed Chromatin Formation and Weak Suppression of Homologous Pairing by the Testis-Specific Linker Histone H1T.
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
22650316 2012 A unified phylogeny-based nomenclature for histone variants.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19820698 2009 Genome-wide association study identifies variants in TMPRSS6 associated with hemoglobin levels.
19806355 2010 An extensive analysis of the hereditary hemochromatosis gene HFE and neighboring histone genes: associations with childhood leukemia.
More...