Property Summary

NCBI Gene PubMed Count 72
PubMed Score 1234.95
PubTator Score 865.28

Knowledge Summary

Patent

No data available

Expression

Gene RIF (57)

AA Sequence

MRRLWGAARKPSGAGWEKEWAEAPQEAPGAWSGRLGPGRSGRKGRAVPGWASWPAHLALAARPARHLGGA      1 - 70
GQGPRPLHSGTAPFHSRASGERQRRLEPQLQHESRCRSSTPADAWRAEAALPVRAMGAPWGSPTAAAGGR     71 - 140
RGWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPD    141 - 210
CRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEAL    211 - 280
ATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPL    281 - 350
SRKQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLD    351 - 420
YITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRR    421 - 490
SYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFER                                  491 - 530
//

Text Mined References (74)

PMID Year Title