Property Summary

NCBI Gene PubMed Count 65
Grant Count 100
R01 Count 42
Funding $10,821,375.38
PubMed Score 1189.46
PubTator Score 865.28

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P22083 B2RMS0
Symbols LeX
CD15
ELFT
FCT3A
FUTIV
SSEA-1
FUC-TIV

Gene

PANTHER Protein Class (2)

Gene RIF (50)

PMID Text
26701615 Our results indicate that FUT4 and miR-224-3p are crucial regulators of cancer response to chemotherapy, and may serve as therapeutic targets to reverse chemotherapy resistance in breast cancer.
26427914 Cancer-related CD15/FUT4 overexpression participates in cetuximab or bevacizumab mechanisms of resistance in metastatic colorectal cancer patients.
26427350 Ginsenoside Rg3 induces FUT4-mediated apoptosis in H. pylori CagA-treated gastric cancer cells by regulating SP1 and HSF1 expressions
26418972 the acquisition of a sialyl moiety by the CD15 antigen may precede the widespread dissemination in Hodgkin lymphoma.
26290260 A subset of choroidal and ciliary body melanomas overexpress the CD15 antigen.
25896022 This study suggests that baicalin facilitates endometrial reproduction via elevating FUT4 expression through Wnt/beta-catenin signaling pathway
25869074 This provides an automated procedure, which shortens the mentally tiring and time-consuming process of microscopic cell counting and thus makes a contribution towards the standardization of tools for diagnosing PJI.
25776515 A significant high expression of FUT4 in breast cancer tissues and serum was found compared to controls.
25697377 Data suggest that changes in DNA methylation in trophoblasts regulate (1) cell mobility/placentation, (2) expression of claudin-4 (CLDN4) and 4-fucosyltransferase (FUT4), and (3) matrix metalloproteinase (MMP2 and MMP9) activity.
25608813 The lower expression of FUT4 in HaCaT cells is correlated with the methylation of CpG island in FUT4 promoter.
More...

AA Sequence

MRRLWGAARKPSGAGWEKEWAEAPQEAPGAWSGRLGPGRSGRKGRAVPGWASWPAHLALAARPARHLGGA      1 - 70
GQGPRPLHSGTAPFHSRASGERQRRLEPQLQHESRCRSSTPADAWRAEAALPVRAMGAPWGSPTAAAGGR     71 - 140
RGWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPD    141 - 210
CRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEAL    211 - 280
ATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPL    281 - 350
SRKQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLD    351 - 420
YITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRR    421 - 490
SYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFER                                  491 - 530
//

Text Mined References (67)

PMID Year Title
26701615 2016 Increased fucosylation has a pivotal role in multidrug resistance of breast cancer cells through miR-224-3p targeting FUT4.
26427914 2015 Cancer-related CD15/FUT4 overexpression decreases benefit to agents targeting EGFR or VEGF acting as a novel RAF-MEK-ERK kinase downstream regulator in metastatic colorectal cancer.
26427350 2016 Ginsenoside Rg3 induces FUT4-mediated apoptosis in H. pylori CagA-treated gastric cancer cells by regulating SP1 and HSF1 expressions.
26418972 2015 Hodgkin lymphoma cell lines bind to platelets. Incubation with platelets induces CD15 and P-selectin dependent adhesion of the cell lines to Human Umbilical Vein Endothelial cells (HUVEC).
26290260 2016 Expression and prognostic value of putative cancer stem cell markers CD117 and CD15 in choroidal and ciliary body melanoma.
25896022 2015 Baicalin promotes embryo adhesion and implantation by upregulating fucosyltransferase IV (FUT4) via Wnt/beta-catenin signaling pathway.
25869074 2015 [CD15 focus score for diagnostics of periprosthetic joint infections : Neutrophilic granulocytes quantification mode and the development of morphometric software (CD15 quantifier)].
25776515 2015 Fucosyltransferase IV (FUT4) as an effective biomarker for the diagnosis of breast cancer.
25697377 2015 Genome-wide DNA methylation identifies trophoblast invasion-related genes: Claudin-4 and Fucosyltransferase IV control mobility via altering matrix metalloproteinase activity.
25608813 2015 Correlation between FUT4 expression and its promoter methylation in HaCaT cells.
More...