Property Summary

NCBI Gene PubMed Count 26
Grant Count 27
R01 Count 14
Funding $2,072,986.91
PubMed Score 204.23
PubTator Score 73.11

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
24692560 Matrilin-1 is an inhibitor of neovascularization
24469715 this meta-analysis found an overall significant association of rs1149048 polymorphism with risk of AIS, especially in Asian population.
22278929 no significant difference in single nucleotide polymorphism between adolescent idiopathic scoliosis cases and controls
22193623 The A allele of single nucleotide polymorphism rs1065755 in the MATN1 gene is associated with adolescent idiopathic scoliosis.
21308753 we concluded that MATN1 SNP is not associated with either adolescent idiopathic scoliosis predisposition or curve severity in Japanese.
20739701 Genotyping results showed Matrilin-1 polymorphism haplotype TGC (ht4; 158T, 7987G, and 8572C alleles) had pronounced risk effect for mandibular prognathism compared with controls.
20739701 Observational study of gene-disease association. (HuGE Navigator)
20729554 Matrilin-1 A-domains have a role in cartilage ECM assembly
20137728 Genotype GG of matrilin-1 gene is indicative of less bracing effectiveness in adolescent idiopathic scoliosis.
20137399 There is an association between matrilin-1 levels and curve progression in adolescent idiopathic scoliosis.
More...

AA Sequence

MRVLSGTSLMLCSLLLLLQALCSPGLAPQSRGHLCRTRPTDLVFVVDSSRSVRPVEFEKVKVFLSQVIES      1 - 70
LDVGPNATRVGMVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAFGDAEGGRS     71 - 140
RSPDISKVVIVVTDGRPQDSVQDVSARARASGVELFAIGVGSVDKATLRQIASEPQDEHVDYVESYSVIE    141 - 210
KLSRKFQEAFCVVSDLCATGDHDCEQVCISSPGSYTCACHEGFTLNSDGKTCNVCSGGGGSSATDLVFLI    211 - 280
DGSKSVRPENFELVKKFISQIVDTLDVSDKLAQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEK    281 - 350
GTMTGAALKYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFAVGVGNAVEDELR    351 - 420
EIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAI    421 - 490
LENTVV                                                                    491 - 496
//

Text Mined References (27)

PMID Year Title
24692560 2014 Matrilin-1 is an inhibitor of neovascularization.
24469715 2014 The association of rs1149048 polymorphism in matrilin-1(MATN1) gene with adolescent idiopathic scoliosis susceptibility: a meta-analysis.
22278929 2012 Single-nucleotide polymorphism in Turkish patients with adolescent idiopathic scoliosis: curve progression is not related with MATN-1, LCT C/T-13910, and VDR BsmI.
22193623 2012 Associations between matrilin-1 gene polymorphisms and adolescent idiopathic scoliosis curve patterns in a Korean population.
21308753 2011 Lack of association between adolescent idiopathic scoliosis and previously reported single nucleotide polymorphisms in MATN1, MTNR1B, TPH1, and IGF1 in a Japanese population.
20739701 2010 Polymorphisms in the Matrilin-1 gene and risk of mandibular prognathism in Koreans.
20729554 2010 Structural and functional investigations of Matrilin-1 A-domains reveal insights into their role in cartilage ECM assembly.
20137728 2009 [Association between matrilin-1 gene polymorphism and bracing effectiveness in adolescent idiopathic scoliosis girls].
20137399 2009 [Decreased circulating matrilin-1 levels in adolescent idiopathic scoliosis].
20092731 2009 [Association between polymorphism of Matrilin-1 gene (MATN1) with susceptibility to adolescent idiopathic scoliosis].
More...