Property Summary

NCBI Gene PubMed Count 107
Grant Count 273
R01 Count 144
Funding $39,480,816.84
PubMed Score 482.66
PubTator Score 502.02

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P21810 D3DWU3 P13247
Symbols PGI
DSPG1
PG-S1
SEMDX
SLRR1A

Gene

BGN

Gene RIF (60)

PMID Text
26459740 biglycan exerts an important role in cell proliferation, migration, invasion and apoptosis in colon cancer.
26275380 BGN might play an important role on metastasis in human endometrial cancer and it might be a target marker for the molecular therapy of advanced and recurrence endometrial cancer.
25578324 This study demonstrated that the small leucine-rich proteoglycan BGN accumulates in CADASIL and binds to NOTCH3.
25463076 Biglycan may have a role in development of vascular damage in smokers
25260943 BGN is a factor secreted by peritubular cells to modulate FGFR3c signaling and thus contributes to the regulation of spermatogonial maintenance
25173489 Data indicate that the biglycan (BGN) CC genotype was significantly over-represented in the control group versus the carpal tunnel syndrome (CTS) group.
24552666 The results suggest that regions within BGN is associated with ACL injury susceptibility and that genetic sequence variability within genes encoding proteoglycans may potentially modulate the ligament fibril properties.
24373744 Biglycan modulates angiogenesis and bone formation during fracture healing.
24257755 Mast cell chymase degrades the alarmins heat shock protein 70, biglycan, HMGB1, and interleukin-33 (IL-33) and limits danger-induced inflammation.
24228112 High expression of BGN in esophageal squamous cell carcinoma indicated aggressive tumor behaviors and predicted a worse clinical outcome.
More...

AA Sequence

MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCH      1 - 70
LRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKL     71 - 140
QKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKL    141 - 210
NYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLR    211 - 280
ELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPA    281 - 350
TFRCVTDRLAIQFGNYKK                                                        351 - 368
//

Text Mined References (112)

PMID Year Title
27236923 2016 BGN Mutations in X-Linked Spondyloepimetaphyseal Dysplasia.
26459740 2015 Knockdown of biglycan expression by RNA interference inhibits the proliferation and invasion of, and induces apoptosis in, the HCT116 colon cancer cell line.
26275380 2016 Biglycan enhances the ability of migration and invasion in endometrial cancer.
25578324 2015 The small leucine-rich proteoglycan BGN accumulates in CADASIL and binds to NOTCH3.
25463076 2014 Biglycan expression in current cigarette smokers: a possible link between active smoking and atherogenesis.
25260943 2015 Biglycan is a novel binding partner of fibroblast growth factor receptor 3c (FGFR3c) in the human testis.
25173489 2014 The BGN and ACAN genes and carpal tunnel syndrome.
24552666 2014 Genes encoding proteoglycans are associated with the risk of anterior cruciate ligament ruptures.
24373744 2014 Biglycan modulates angiogenesis and bone formation during fracture healing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...