Property Summary

NCBI Gene PubMed Count 115
PubMed Score 529.95
PubTator Score 502.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Aortic aneurysm 38 0.0 4.0

Expression

  Differential Expression (31)

Disease log2 FC p
adult high grade glioma 1.100 6.5e-03
Astrocytoma, Pilocytic 2.100 3.8e-07
Breast cancer 3.100 2.2e-20
breast carcinoma 1.100 3.4e-12
colon cancer 1.800 9.4e-03
cutaneous lupus erythematosus -1.200 2.9e-02
diabetes mellitus -1.600 4.3e-02
Duchenne muscular dystrophy 1.194 2.6e-06
ductal carcinoma in situ 1.600 6.7e-03
ependymoma 1.700 6.3e-08
esophageal adenocarcinoma 1.100 2.4e-02
gastric carcinoma 2.900 9.7e-03
Gaucher disease type 1 1.700 6.5e-03
glioblastoma 1.200 1.9e-04
interstitial cystitis 1.300 5.5e-04
intraductal papillary-mucinous adenoma (... -1.600 8.6e-03
intraductal papillary-mucinous carcinoma... -1.800 1.2e-02
intraductal papillary-mucinous neoplasm ... -1.700 2.7e-02
invasive ductal carcinoma 1.921 6.6e-04
limb girdle muscular dystrophy 2A 1.129 1.1e-04
lung cancer 1.300 1.9e-04
malignant mesothelioma 4.800 5.4e-08
ovarian cancer 3.000 4.5e-07
pancreatic cancer 1.100 6.7e-03
pancreatic ductal adenocarcinoma liver m... 1.320 9.0e-03
psoriasis -1.100 2.1e-04
pterygium 1.100 5.6e-03
sonic hedgehog group medulloblastoma 1.300 9.5e-04
ulcerative colitis 1.100 1.1e-02
urothelial carcinoma 1.200 9.2e-03
X-linked cerebral adrenoleukodystrophy 1.100 4.6e-02

Protein-protein Interaction (3)

Gene RIF (65)

AA Sequence

MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCH      1 - 70
LRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKL     71 - 140
QKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKL    141 - 210
NYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLR    211 - 280
ELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPA    281 - 350
TFRCVTDRLAIQFGNYKK                                                        351 - 368
//

Text Mined References (118)

PMID Year Title