Property Summary

NCBI Gene PubMed Count 165
PubMed Score 814.75
PubTator Score 500.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.300 4.6e-02
Breast cancer 3.400 2.6e-02
lung adenocarcinoma 1.379 9.4e-09
Multiple myeloma 2.047 3.9e-04
osteosarcoma 1.155 2.2e-03
ovarian cancer 2.800 4.4e-05

Protein-protein Interaction (1)

Gene RIF (109)

AA Sequence

MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLT      1 - 70
FTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRG     71 - 140
ALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAW    141 - 210
TAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLE    211 - 280
FQA                                                                       281 - 283
//

Text Mined References (181)

PMID Year Title