Property Summary

NCBI Gene PubMed Count 152
Grant Count 433
R01 Count 284
Funding $74,691,989.56
PubMed Score 762.80
PubTator Score 500.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 2.047 0.000
astrocytic glioma -1.300 0.046
osteosarcoma 1.155 0.002
Breast cancer 3.400 0.026
lung adenocarcinoma 1.379 0.000
ovarian cancer 2.800 0.000

Synonym

Accession P21796 B3KVK4 D3DQ93 Q5FVE7 Q9UIQ5 Q9UPL0 VDAC-1
Symbols PORIN
VDAC-1

Gene

PDB

2JK4   2K4T   5JDP  

Gene RIF (99)

PMID Text
27080741 Reducing VDAC1 expression induces a non-apoptotic role for pro-apoptotic proteins in glioblastoma multiforme cancer cell differentiation.
26947058 The works available on VDAC cysteines support the notion that VDAC1, VDAC2, and VDAC3 proteins are paralogs with a similar pore-function and slightly different, but important, ancillary biological functions. (Review)
26801612 The protective effect of miR-7 is partly exerted through promoting mitochondrial function by targeting VDAC1 expression.
26716410 High VDAC1 expression is associated with cervical cancer.
26655341 Data show that voltage-dependent anion channel 1 (VDAC1) knockout cells are resistant to AMP-activated protein kinase (AMPK) and mechanistic target of rapamycin (mTOR) modulation by itraconazole, indicating VDAC1 is the mediator of the activity.
26646027 findings also suggest that VDAC1 may be a novel biomarker for gastric cancer
26542804 Amyloid beta -mediated toxicity involves mitochondrial and plasma membrane VDAC1, leading to mitochondrial dysfunction and apoptosis induction.
26472185 serum starvation induces CREB1 expression, in turn activating miR-320a expression, which then down-regulates VDAC1 expression to facilitate mitophagy
26462148 Studies using B16F10 and A375 cells genetically modified for ATF2 indicated that mitochondrial ATF2 was able to dissociate Bim from the Mcl-1/Bim complex to trigger VDAC1 oligomerization.
26191154 PGC-1alpha deficiency exacerbates high glucose-induced apoptosis in human umbilical vein endothelial cells through activation of VADC1.
More...

AA Sequence

MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLT      1 - 70
FTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRG     71 - 140
ALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAW    141 - 210
TAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLE    211 - 280
FQA                                                                       281 - 283
//

Text Mined References (168)

PMID Year Title
27080741 2016 Reducing VDAC1 expression induces a non-apoptotic role for pro-apoptotic proteins in cancer cell differentiation.
26947058 2016 Role of cysteines in mammalian VDAC isoforms' function.
26801612 2016 MicroRNA-7 Regulates the Function of Mitochondrial Permeability Transition Pore by Targeting VDAC1 Expression.
26716410 2016 Clinical implication of voltage-dependent anion channel 1 in uterine cervical cancer and its action on cervical cancer cells.
26655341 2015 Antifungal drug itraconazole targets VDAC1 to modulate the AMPK/mTOR signaling axis in endothelial cells.
26646027 2015 Mitochondrial Proteomics Approach Reveals Voltage-Dependent Anion Channel 1 (VDAC1) as a Potential Biomarker of Gastric Cancer.
26542804 2015 The Voltage-dependent Anion Channel 1 Mediates Amyloid ? Toxicity and Represents a Potential Target for Alzheimer Disease Therapy.
26472185 2015 CREB1-driven expression of miR-320a promotes mitophagy by down-regulating VDAC1 expression during serum starvation in cervical cancer cells.
26462148 2015 Mitochondrial ATF2 translocation contributes to apoptosis induction and BRAF inhibitor resistance in melanoma through the interaction of Bim with VDAC1.
26191154 2015 Lack of PGC-1? exacerbates high glucose-induced apoptosis in human umbilical vein endothelial cells through activation of VADC1.
More...