Property Summary

NCBI Gene PubMed Count 108
PubMed Score 149.26
PubTator Score 211.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.422 1.5e-02
astrocytoma 1.400 2.2e-07
Astrocytoma, Pilocytic 1.600 9.7e-05
Breast cancer 2.700 2.6e-02
gastric carcinoma 1.500 4.9e-02
glioblastoma 1.500 3.0e-03
intraductal papillary-mucinous adenoma (... -1.300 3.2e-02
invasive ductal carcinoma 2.757 7.2e-05
lung adenocarcinoma -1.300 3.0e-06
lung cancer -1.500 7.1e-03
lung carcinoma -4.000 5.9e-32
non-small cell lung cancer -1.707 7.7e-13
osteosarcoma 1.980 7.5e-03
ovarian cancer -2.100 4.6e-06
pediatric high grade glioma 1.500 1.1e-02
posterior fossa group A ependymoma 1.100 1.7e-02
Rheumatoid arthritis 2.400 4.0e-04
subependymal giant cell astrocytoma 1.235 4.0e-02
tuberculosis and treatment for 6 months -1.100 3.5e-02

Protein-protein Interaction (3)

Gene RIF (97)

AA Sequence

MEQWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAALIALYLLVFAVLIPLIGI      1 - 70
VAAQLLKWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEH     71 - 140
FQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQE    141 - 210
EISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPGPPGE    211 - 280
KGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLTPFTKV    281 - 350
RLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQGTGPIWLNEVFCF    351 - 420
GRESSIEECKIRQWGTRACSHSEDAGVTCTL                                           421 - 451
//

Text Mined References (111)

PMID Year Title