Property Summary

NCBI Gene PubMed Count 102
Grant Count 36
R01 Count 18
Funding $5,590,809.97
PubMed Score 129.71
PubTator Score 211.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (92)

PMID Text
26892079 Identifying N-linked glycan moiety and motifs in the cysteine-rich domain critical for N-glycosylation and intracellular trafficking of SR-AI and MARCO.
26225686 The P275A Polymorphism in the Macrophage Scavenger Receptor 1 Gene is not associated with Prostate Cancer Risk.
26056009 miR-29a promotes scavenger receptor A expression by targeting QKI during monocyte-macrophage differentiation.
26001293 Findings suggest that CD204+ Mphis might play detrimental protumoral roles and represent the predominant Mphi phenotype in human bladder cancer.
25620088 Cyr61 promotes CD204 expression and the migration of macrophages via MEK/ERK pathway in esophageal squamous cell carcinoma
25186548 The truncating variant Arg293X in the gene encoding SRA-I/II was associated with reduced lung function and with increased risk of COPD among men, as well as among alpha1-antitrypsin MZ and superoxide dismutase-3 E1I1 heterozygotes.
24839953 High CD204 expression is an independent predictor for both overall and disease-free survival in pancreatic ductal adenocarcinoma.
24718459 Heptapeptide XD4 activates the class A scavenger receptor (SR-A) on the glia by increasing the binding of Abeta to SR-A, thereby promoting glial phagocytosis of Abeta oligomer in microglia.
24604828 rs6966 (3' UTR of PPP1R13L, chr 19q13.32, P = 4.55 x 10(-9)) and rs414580 (intron 2 of MSR1, chr 8p22, P = 6.09 x 10(-8)) were significantly associated with ALL.
24498098 There was a significant negative correlation between the number of CD163(+), CD204(+) or CD206(+) alveolar macrophages.
More...

AA Sequence

MEQWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAALIALYLLVFAVLIPLIGI      1 - 70
VAAQLLKWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEH     71 - 140
FQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQE    141 - 210
EISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPGPPGE    211 - 280
KGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLTPFTKV    281 - 350
RLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQGTGPIWLNEVFCF    351 - 420
GRESSIEECKIRQWGTRACSHSEDAGVTCTL                                           421 - 451
//

Text Mined References (105)

PMID Year Title
26892079 2016 Identifying N-linked glycan moiety and motifs in the cysteine-rich domain critical for N-glycosylation and intracellular trafficking of SR-AI and MARCO.
26225686 2015 The P275A Polymorphism in the Macrophage Scavenger Receptor 1 Gene and Prostate Cancer Risk: a Meta-Analysis.
26056009 2015 miR-29a promotes scavenger receptor A expression by targeting QKI (quaking) during monocyte-macrophage differentiation.
26001293 2015 High CD204+ tumor-infiltrating macrophage density predicts a poor prognosis in patients with urothelial cell carcinoma of the bladder.
25965346 2015 SP-R210 (Myo18A) Isoforms as Intrinsic Modulators of Macrophage Priming and Activation.
25620088 2015 Cyr61 promotes CD204 expression and the migration of macrophages via MEK/ERK pathway in esophageal squamous cell carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25186548 2014 Genetic variations in scavenger and ??-adrenergic receptors and risk of pulmonary disease.
24839953 2014 Coexpression of CD44-positive/CD133-positive cancer stem cells and CD204-positive tumor-associated macrophages is a predictor of survival in pancreatic ductal adenocarcinoma.
24718459 2014 Activated scavenger receptor A promotes glial internalization of a?.
More...