Property Summary

NCBI Gene PubMed Count 102
PubMed Score 129.71
PubTator Score 211.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 5.88695110110446E-32
non-small cell lung cancer 2798 3.38375144573822E-22
lung adenocarcinoma 2714 1.81177675335824E-7
astrocytoma 1493 2.22565665891873E-7
ovarian cancer 8492 4.63865880323826E-6
lung cancer 4473 4.58132091154299E-5
invasive ductal carcinoma 2950 7.23763539456502E-5
pilocytic astrocytoma 3086 1.35852364013871E-4
Rheumatoid Arthritis 1171 4.0242244191233E-4
glioblastoma 5572 4.29915760201467E-4
osteosarcoma 7933 0.00669522527611673
pediatric high grade glioma 2712 0.0108152689766145
adrenocortical carcinoma 1427 0.014735224147311
posterior fossa group A ependymoma 1511 0.0165617813285704
Breast cancer 3099 0.0259889637897627
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0319990253228367
tuberculosis and treatment for 6 months 686 0.0350106461332155
subependymal giant cell astrocytoma 2287 0.0488857797113194
gastric carcinoma 832 0.0492569437615774
Disease Target Count Z-score Confidence
Cancer 2346 3.7 1.8
Disease Target Count
Barrett Esophagus 20

Expression

  Differential Expression (19)

Synonym

Accession P21757 D3DSP3 O60505 P21759 Q45F10
Symbols SRA
SR-A
CD204
phSR1
phSR2
SCARA1

Gene

  Ortholog (10)

Gene RIF (92)

PMID Text
26892079 Identifying N-linked glycan moiety and motifs in the cysteine-rich domain critical for N-glycosylation and intracellular trafficking of SR-AI and MARCO.
26225686 The P275A Polymorphism in the Macrophage Scavenger Receptor 1 Gene is not associated with Prostate Cancer Risk.
26056009 miR-29a promotes scavenger receptor A expression by targeting QKI during monocyte-macrophage differentiation.
26001293 Findings suggest that CD204+ Mphis might play detrimental protumoral roles and represent the predominant Mphi phenotype in human bladder cancer.
25620088 Cyr61 promotes CD204 expression and the migration of macrophages via MEK/ERK pathway in esophageal squamous cell carcinoma
25186548 The truncating variant Arg293X in the gene encoding SRA-I/II was associated with reduced lung function and with increased risk of COPD among men, as well as among alpha1-antitrypsin MZ and superoxide dismutase-3 E1I1 heterozygotes.
24839953 High CD204 expression is an independent predictor for both overall and disease-free survival in pancreatic ductal adenocarcinoma.
24718459 Heptapeptide XD4 activates the class A scavenger receptor (SR-A) on the glia by increasing the binding of Abeta to SR-A, thereby promoting glial phagocytosis of Abeta oligomer in microglia.
24604828 rs6966 (3' UTR of PPP1R13L, chr 19q13.32, P = 4.55 x 10(-9)) and rs414580 (intron 2 of MSR1, chr 8p22, P = 6.09 x 10(-8)) were significantly associated with ALL.
24498098 There was a significant negative correlation between the number of CD163(+), CD204(+) or CD206(+) alveolar macrophages.
More...

AA Sequence

MEQWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAALIALYLLVFAVLIPLIGI      1 - 70
VAAQLLKWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEH     71 - 140
FQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQE    141 - 210
EISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPGPPGE    211 - 280
KGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLTPFTKV    281 - 350
RLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQGTGPIWLNEVFCF    351 - 420
GRESSIEECKIRQWGTRACSHSEDAGVTCTL                                           421 - 451
//

Text Mined References (105)

PMID Year Title
26892079 2016 Identifying N-linked glycan moiety and motifs in the cysteine-rich domain critical for N-glycosylation and intracellular trafficking of SR-AI and MARCO.
26225686 2015 The P275A Polymorphism in the Macrophage Scavenger Receptor 1 Gene and Prostate Cancer Risk: a Meta-Analysis.
26056009 2015 miR-29a promotes scavenger receptor A expression by targeting QKI (quaking) during monocyte-macrophage differentiation.
26001293 2015 High CD204+ tumor-infiltrating macrophage density predicts a poor prognosis in patients with urothelial cell carcinoma of the bladder.
25965346 2015 SP-R210 (Myo18A) Isoforms as Intrinsic Modulators of Macrophage Priming and Activation.
25620088 2015 Cyr61 promotes CD204 expression and the migration of macrophages via MEK/ERK pathway in esophageal squamous cell carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25186548 2014 Genetic variations in scavenger and ??-adrenergic receptors and risk of pulmonary disease.
24839953 2014 Coexpression of CD44-positive/CD133-positive cancer stem cells and CD204-positive tumor-associated macrophages is a predictor of survival in pancreatic ductal adenocarcinoma.
24718459 2014 Activated scavenger receptor A promotes glial internalization of a?.
More...