Property Summary

NCBI Gene PubMed Count 129
Grant Count 143
R01 Count 53
Funding $15,520,216.44
PubMed Score 420.43
PubTator Score 194.56

Knowledge Summary

Patent (14,826)

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.000
osteosarcoma 1.374 0.000
juvenile dermatomyositis 1.046 0.000
group 3 medulloblastoma 1.100 0.007

Synonym

Accession P21675 A5CVC8 A5CVC9 A5CVD0 A5CVD1 B1Q2X3 Q59FZ3 Q6IUZ1 Q70Q86 Q70Q87 Q70T00 Q70T01 Q70T02 Q70T03
Symbols OF
XDP
BA2R
CCG1
CCGS
DYT3
KAT4
P250
NSCL2
TAF2A
MRXS33
N-TAF1
TAFII250
DYT3/TAF1
TAFII-250
TAF(II)250

Gene

PDB

5FUR   4YYM   4YYN   4RGW   1EQF   3AAD   3UV4   3UV5   5I1Q   5I29  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

Gene RIF (60)

PMID Text
26637982 TAF1 variants are associated with dysmorphic features, intellectual disability, and neurological manifestations.
26365797 The bromodomains of BRD9, CECR2, and the second bromodomain of TAF1 recognize the longer butyryl mark on histones. In addition, the TAF1 second bromodomain is capable of binding crotonyl marks.
25412659 TAF1 winged helix domain has intrinsic DNA-binding activity, which depends on characteristic residues that are commonly used by winged helix fold proteins for interacting with DNA.
24928901 are necessary and sufficient to overcome the barrier of species specificity for human rDNA transcription in mouse cells
24927529 the surface of the TAF1-TAF7 complex contains two prominent conserved surface pockets, one of which binds selectively to an inhibitory trimethylated histone H3
24289924 As cellular ATP levels recover, TAF1 is able to phosphorylate p53 on Thr55, which leads to dissociation of p53 from the p21 promoter.
23831825 Lower efficiency of microRNA synthesis directed by TATA box or NF-kappaappaB is a consequence of frequent transcription initiations that lead to RNA polymerase II crowding at pause sites and premature termination.
23827503 HIV-1 Tat stimulates the phosphorylation of TFIIF by TAFII250 during Tat-mediated transcription of the HIV-1 LTR promoter
23827503 HIV-1 Tat stimulates the phosphorylation of TFIIF by TAFII250 during Tat-mediated transcription of the HIV-1 LTR promoter
23518577 HIV-1 Tat stimulates the phosphorylation of TFIIF by TAFII250 during Tat-mediated transcription of the HIV-1 LTR promoter
More...

AA Sequence

MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDDECKKHLAGLG      1 - 70
ALGLGSLITELTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDESRRYQQTMGSLQPLCHSDYD     71 - 140
EDDYDADCEDIDCKLMPPPPPPPGPMKKDKDQDSITGEKVDFSSSSDSESEMGPQEATQAESEDGKLTLP    141 - 210
LAGIMQHDATKLLPSVTELFPEFRPGKVLRFLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVEC    211 - 280
SVESEVSQKSLWNYDYAPPPPPEQCLSDDEITMMAPVESKFSQSTGDIDKVTDTKPRVAEWRYGPARLWY    281 - 350
DMLGVPEDGSGFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLADENFLMVTQLHWEDDIIWDGED    351 - 420
VKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLDDDKPWYSIFPIDNEDLVYGRWEDNIIWDAQA    421 - 490
MPRLLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSRILLGKTGVIKEEPQQNMSQPE    491 - 560
VKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQ    561 - 630
PGPHSVQPLLKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKI    631 - 700
KNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQG    701 - 770
YYIRELVDIFVVGQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSES    771 - 840
SIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCAYYSMIAAEQRLKDAGYGEKSFFA    841 - 910
PEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCGEGFSYVKIPNKPTQQKDDKE    911 - 980
PQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSGEGPMSKFARG    981 - 1050
SRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSRE   1051 - 1120
REEQERKELQRMLLAAGSAASGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAV   1121 - 1190
IDAYVRIRTTKDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKKPKKMKERPDL   1191 - 1260
KLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQEEELEKTVIHNDNEELIKVEGTKIVLGKQLI   1261 - 1330
ESADEVRRKSLVLKFPKQQLPPKKKRRVGTTVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLP   1331 - 1400
NTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQIS   1401 - 1470
QSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDY   1471 - 1540
YKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEH   1541 - 1610
LTQLEKDICTAKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMSRDASVFQDESNMSVLDIPSAT   1611 - 1680
PEKQVTQEGEDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSAIQLSESGSDS   1681 - 1750
DVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSI   1751 - 1820
GGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE                     1821 - 1872
//

Text Mined References (135)

PMID Year Title
27007846 2016 Structure of promoter-bound TFIID and model of human pre-initiation complex assembly.
26637982 2015 TAF1 Variants Are Associated with Dysmorphic Features, Intellectual Disability, and Neurological Manifestations.
26365797 2015 A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
25412659 2014 Crystal structure of a TAF1-TAF7 complex in human transcription factor IID reveals a promoter binding module.
24928901 2014 Reconstitution of human rRNA gene transcription in mouse cells by a complete SL1 complex.
24927529 2014 Structural and functional insight into TAF1-TAF7, a subcomplex of transcription factor II D.
24289924 2014 Phosphorylation of p53 by TAF1 inactivates p53-dependent transcription in the DNA damage response.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23831825 2013 Disparity between microRNA levels and promoter strength is associated with initiation rate and Pol II pausing.
23264082 2013 TAFI gene polymorphisms in patients with cerebral venous thrombosis.
More...