Property Summary

NCBI Gene PubMed Count 122
PubMed Score 806.62
PubTator Score 496.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.5
Liver cancer 604 0.0 0.7

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy -1.003 8.7e-07
aldosterone-producing adenoma 1.569 1.9e-02
Astrocytoma, Pilocytic 1.500 5.5e-07
cutaneous lupus erythematosus -1.200 1.4e-02
glioblastoma 1.900 4.1e-07
medulloblastoma 1.600 3.3e-04
ovarian cancer -2.500 2.6e-08
pancreatic ductal adenocarcinoma liver m... -2.857 2.7e-02
pediatric high grade glioma 2.300 2.4e-10
psoriasis -1.600 3.1e-04
Waldenstrons macroglobulinemia -1.725 1.9e-03

Gene RIF (119)

AA Sequence

MDLEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQDKLFMSLGTIMAIAHGSG      1 - 70
LPLMMIVFGEMTDKFVDTAGNFSFPVNFSLSLLNPGKILEEEMTRYAYYYSGLGAGVLVAAYIQVSFWTL     71 - 140
AAGRQIRKIRQKFFHAILRQEIGWFDINDTTELNTRLTDDISKISEGIGDKVGMFFQAVATFFAGFIVGF    141 - 210
IRGWKLTLVIMAISPILGLSAAVWAKILSAFSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQ    211 - 280
KHLENAKEIGIKKAISANISMGIAFLLIYASYALAFWYGSTLVISKEYTIGNAMTVFFSILIGAFSVGQA    281 - 350
APCIDAFANARGAAYVIFDIIDNNPKIDSFSERGHKPDSIKGNLEFNDVHFSYPSRANVKILKGLNLKVQ    351 - 420
SGQTVALVGSSGCGKSTTVQLIQRLYDPDEGTINIDGQDIRNFNVNYLREIIGVVSQEPVLFSTTIAENI    421 - 490
CYGRGNVTMDEIKKAVKEANAYEFIMKLPQKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEAT    491 - 560
SALDTESEAEVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFEDGVIVEQGSHSELMKKEGVYFKLVNM    561 - 630
QTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVSFLKV    631 - 700
LKLNKTEWPYFVVGTVCAIANGGLQPAFSVIFSEIIAIFGPGDDAVKQQKCNIFSLIFLFLGIISFFTFF    701 - 770
LQGFTFGKAGEILTRRLRSMAFKAMLRQDMSWFDDHKNSTGALSTRLATDAAQVQGATGTRLALIAQNIA    771 - 840
NLGTGIIISFIYGWQLTLLLLAVVPIIAVSGIVEMKLLAGNAKRDKKELEAAGKIATEAIENIRTVVSLT    841 - 910
QERKFESMYVEKLYGPYRNSVQKAHIYGITFSISQAFMYFSYAGCFRFGAYLIVNGHMRFRDVILVFSAI    911 - 980
VFGAVALGHASSFAPDYAKAKLSAAHLFMLFERQPLIDSYSEEGLKPDKFEGNITFNEVVFNYPTRANVP    981 - 1050
VLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGTVFVDFGFQLLDGQEAKKLNVQWLRAQLG   1051 - 1120
IVSQEPILFDCSIAENIAYGDNSRVVSQDEIVSAAKAANIHPFIETLPHKYETRVGDKGTQLSGGQKQRI   1121 - 1190
AIARALIRQPQILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEH   1191 - 1260
GTHQQLLAQKGIYFSMVSVQAGTQNL                                               1261 - 1286
//

Text Mined References (128)

PMID Year Title