Property Summary

NCBI Gene PubMed Count 131
PubMed Score 746.72
PubTator Score 367.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Barrett's esophagus -1.200 2.3e-02
Breast cancer -6.400 7.3e-59
breast carcinoma -1.500 2.7e-02
colon cancer -2.100 2.3e-04
Crohn's disease -1.845 1.8e-03
Endometriosis -1.100 5.0e-02
esophageal adenocarcinoma -1.900 2.5e-02
glioblastoma 1.100 5.3e-05
group 3 medulloblastoma -1.400 7.7e-04
interstitial cystitis -1.200 4.1e-02
intraductal papillary-mucinous adenoma (... -2.300 1.6e-06
intraductal papillary-mucinous carcinoma... -2.300 4.9e-04
intraductal papillary-mucinous neoplasm ... -1.100 5.0e-03
juvenile dermatomyositis 1.565 1.1e-10
lung adenocarcinoma -1.900 3.0e-04
lung cancer -1.800 1.7e-02
malignant mesothelioma -4.300 2.3e-09
medulloblastoma, large-cell -2.800 1.6e-04
nasopharyngeal carcinoma -1.100 4.7e-02
non primary Sjogren syndrome sicca 1.400 2.7e-02
osteosarcoma 4.023 5.2e-03
ovarian cancer 1.400 3.7e-02
pediatric high grade glioma 1.200 9.6e-04
psoriasis -1.500 1.2e-05
severe Alzheimer's disease -1.020 1.4e-02
ulcerative colitis -1.581 4.8e-03

Synonym

Accession P21246 Q5U0B0 Q6ICQ5 Q9UCC6 PTN
Symbols HARP
HBBM
HBNF
HBGF8
NEGF1
OSF-1
HB-GAM
HBGF-8
HBNF-1

Gene

PTN

PANTHER Protein Class (2)

PDB

2N6F  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (91)

AA Sequence

MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGT      1 - 70
RTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKP     71 - 140
CGKLTKPKPQAESKKKKKEGKKQEKMLD                                              141 - 168
//

Text Mined References (134)

PMID Year Title