Property Summary

NCBI Gene PubMed Count 122
PubMed Score 697.42
PubTator Score 367.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
Breast cancer 3099 5.16942916847297E-51
breast carcinoma 1614 2.20547714342163E-25
juvenile dermatomyositis 1189 1.05645134127312E-10
malignant mesothelioma 3163 2.28343080295841E-9
intraductal papillary-mucinous adenoma (IPMA) 2956 3.25149656173044E-5
colon cancer 1475 5.53895545531082E-5
medulloblastoma, large-cell 6234 6.78516000819052E-5
group 3 medulloblastoma 2254 1.48355332751662E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.86877818812616E-4
lung adenocarcinoma 2714 2.97837174593104E-4
ovarian cancer 8492 7.40072408299999E-4
pediatric high grade glioma 2712 9.59543055505917E-4
Crohn's disease 304 0.00180260734584949
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00218606313930104
ulcerative colitis 2087 0.00475329055076081
osteosarcoma 7933 0.00520676950489987
glioblastoma 5572 0.00605904229759798
psoriasis 6685 0.00910777869102824
severe Alzheimer's disease 49 0.0144322899198522
lung cancer 4473 0.0174108009056678
esophageal adenocarcinoma 737 0.020206322103253
Barrett's esophagus 185 0.0259963614651457
non primary Sjogren syndrome sicca 840 0.0266048727755267
interstitial cystitis 2299 0.0384611849887792
nasopharyngeal carcinoma 1056 0.0470729277921249
Endometriosis 535 0.0497866129258966
Disease Target Count Z-score Confidence
Cognitive disorder 44 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 4.22 2.1
Peyronie's disease 8 3.196 1.6

Expression

  Differential Expression (26)

Synonym

Accession P21246 Q5U0B0 Q6ICQ5 Q9UCC6 PTN
Symbols HARP
HBBM
HBNF
HBGF8
NEGF1
OSF-1
HB-GAM
HBGF-8
HBNF-1

Gene

PTN

PANTHER Protein Class (2)

PDB

2N6F  

  Ortholog (10)

Gene RIF (83)

PMID Text
27089523 PTN levels in amniotic fluid were found to be lower in pregnancies complicated by chorioamnionitis than in healthy pregnancies.
26914549 Increased Pleiotrophin Concentrations in Papillary Thyroid Cancer
26645582 findings link pleiotrophin abundance in gliomas with survival in humans and mice, and show that pleiotrophin promotes glioma progression through increased VEGF deposition and vascular abnormalization.
26408254 Data show that binding of pleiotrophin (PTN) to neuropilin-1 (NRP-1) stimulated the internalization and recycling of NRP-1 at the cell surface.
25864755 PTN was found to express abnormally high in lung cancer, especially small cell lung cancer tissue.
25743809 High serum pleiotrophin levels are associated with non-small cell lung cancer.
25436328 Over expression of PTN is significantly correlated with poor prognosis in gastric cancer patients.
25418856 PTN and its signaling components may be of significance in the pathogenesis of epithelial ovarian cancer.
25141921 PTN decreased melanogenesis, probably through MITF degradation via Erk1/2 activation in melanocytes.
25001988 PTN expression in glioma was higher than in paratumor tissues. Overexpression was associated with the WHO grade, low Karnofsky score, time to recurrence, and poor survival. Co-expression of midkine and PTN had a worse prognosis than either alone.
More...

AA Sequence

MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGT      1 - 70
RTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKP     71 - 140
CGKLTKPKPQAESKKKKKEGKKQEKMLD                                              141 - 168
//

Text Mined References (126)

PMID Year Title
27089523 2016 Midkine and Pleiotrophin Concentrations in Amniotic Fluid in Healthy and Complicated Pregnancies.
26914549 2016 Increased Pleiotrophin Concentrations in Papillary Thyroid Cancer.
26896299 2016 Structural studies reveal an important role for the pleiotrophin C-terminus in mediating interactions with chondroitin sulfate.
26645582 2015 Pleiotrophin promotes vascular abnormalization in gliomas and correlates with poor survival in patients with astrocytomas.
26408254 2015 Pleiotrophin exerts its migration and invasion effect through the neuropilin-1 pathway.
25864755 Expression of pleiotrophin in small cell lung cancer.
25743809 2015 Serum pleiotrophin could be an early indicator for diagnosis and prognosis of non-small cell lung cancer.
25436328 Increased expression of pleiotrophin is a prognostic marker for patients with gastric cancer.
25418856 2015 PTN signaling: Components and mechanistic insights in human ovarian cancer.
25141921 2015 Pleiotrophin inhibits melanogenesis via Erk1/2-MITF signaling in normal human melanocytes.
More...