Property Summary

NCBI Gene PubMed Count 10
PubMed Score 34.62
PubTator Score 457.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.2e-07
group 3 medulloblastoma 4104 7.9e-04
esophageal adenocarcinoma 737 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Mucinous cystadenocarcinoma 4 3.474 1.7
Choriocarcinoma 14 3.035 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
esophageal adenocarcinoma -3.500 1.9e-02
group 3 medulloblastoma -1.300 7.9e-04
psoriasis 1.400 2.2e-07

Gene RIF (2)

AA Sequence

MRACISLVLAVLCGLAWAGKIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTEDHKESEPLPQ      1 - 70
LEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQEFGNCCKDFESLCSDHEVSHSSDAITKEE     71 - 140
IQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQ    141 - 210
RATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDS    211 - 280
SGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFI    281 - 350
GSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST              351 - 410
//

Text Mined References (12)

PMID Year Title