Property Summary

NCBI Gene PubMed Count 49
Grant Count 161
R01 Count 69
Funding $33,624,712.5
PubMed Score 745.20
PubTator Score 567.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -1.300 0.000
glioblastoma -1.700 0.002
oligodendroglioma -1.600 0.000
posterior fossa group A ependymoma -2.500 0.000
sonic hedgehog group medulloblastoma -2.600 0.001
atypical teratoid/rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell -1.400 0.001
pediatric high grade glioma -2.100 0.001
pilocytic astrocytoma -2.000 0.002
subependymal giant cell astrocytoma -4.272 0.002
Pick disease -1.500 0.017
progressive supranuclear palsy -1.500 0.029
Down syndrome 1.300 0.008
psoriasis -1.800 0.000

Synonym

Accession P20916 B7Z2E5 F5GYC0 Q567S4
Symbols GMA
S-MAG
SPG75
SIGLEC4A
SIGLEC-4A

Gene

MAG

 GO Function (1)

Gene RIF (22)

PMID Text
26179919 This study identify involvement of myelin-associated glycoprotein in this family with a disorder affecting the central and peripheral nervous system, and suggest that loss of the protein function is responsible for the unique clinical phenotype
26065001 polyneuropathy associated with anti-MAG antibodies is less homogeneous.
24129569 LRP1 assembles unique co-receptor systems to initiate cell signaling in response to tissue-type plasminogen activator and myelin-associated glycoprotein.
23726766 Increased serum levels of MAG (and MBP) were found in autistic patients with allergic manifestations compared to those without these manifestations.
22940629 Results show that MAG is important for axon-glia contact in a model for Charcot-Marie-Tooth disease type 1A, and suggest that its increased expression in patients has a compensatory role in the disease pathology
22491194 Primary mitochondrial respiratory chain defects affecting the white matter, and unrelated to inflammation, are associated with MAG loss and central nervous system demyelination.
21199182 Distal acquired demyelinating symmetric neuropathy without anti-MAG antibodies is more likely to be considered a variant of chronic inflammatory demyelinating polyradiculoneuropathy, including a hematological or immunological condition.
19725832 polysialylated NCAM persistence, up-regulated polysialyltransferase-1 mRNA and previously uncovered defective myelin-associated glycoprotein may be early pathogenetic events in adult-onset autosomal-dominant leukodystrophy
19720975 ELISA is more sensitive than Western blot to diagnose anti-myelin-associated glycoprotein related polyneuropathy, although a positive serology may be found in other forms of polyneuropathy as well.
19151627 Taken together, these findings suggest that in anti-MAG neuropathy patients, IgM deposits are entrapped within cutaneous perineurium-ensheathed nerve bundles where they accumulate in the endoneurial space.
More...

AA Sequence

MIFLTALPLFWIMISASRGGHWGAWMPSSISAFEGTCVSIPCRFDFPDELRPAVVHGVWYFNSPYPKNYP      1 - 70
PVVFKSRTQVVHESFQGRSRLLGDLGLRNCTLLLSNVSPELGGKYYFRGDLGGYNQYTFSEHSVLDIVNT     71 - 140
PNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTREA    141 - 210
NGHRLGCQASFPNTTLQFEGYASMDVKYPPVIVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGTVL    211 - 280
REAVAESLLLELEEVTPAEDGVYACLAENAYGQDNRTVGLSVMYAPWKPTVNGTMVAVEGETVSILCSTQ    281 - 350
SNPDPILTIFKEKQILSTVIYESELQLELPAVSPEDDGEYWCVAENQYGQRATAFNLSVEFAPVLLLESH    351 - 420
CAAARDTVQCLCVVKSNPEPSVAFELPSRNVTVNESEREFVYSERSGLVLTSILTLRGQAQAPPRVICTA    421 - 490
RNLYGAKSLELPFQGAHRLMWAKIGPVGAVVAFAILIAIVCYITQTRRKKNVTESPSFSAGDNPPVLFSS    491 - 560
DFRISGAPEKYESERRLGSERRLLGLRGEPPELDLSYSHSDLGKRPTKDSYTLTEELAEYAEIRVK        561 - 626
//

Text Mined References (50)

PMID Year Title
26179919 2015 Myelin-associated glycoprotein gene mutation causes Pelizaeus-Merzbacher disease-like disorder.
26065001 2015 Heterogeneity of Polyneuropathy Associated with Anti-MAG Antibodies.
24482476 2014 Exome sequencing links corticospinal motor neuron disease to common neurodegenerative disorders.
24129569 2013 LRP1 assembles unique co-receptor systems to initiate cell signaling in response to tissue-type plasminogen activator and myelin-associated glycoprotein.
23726766 2013 The possible relationship between allergic manifestations and elevated serum levels of brain specific auto-antibodies in autistic children.
22940629 2013 An essential role of MAG in mediating axon-myelin attachment in Charcot-Marie-Tooth 1A disease.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22491194 2012 Loss of myelin-associated glycoprotein in kearns-sayre syndrome.
21199182 2011 Non-anti-MAG DADS neuropathy as a variant of CIDP: clinical, electrophysiological, laboratory features and response to treatment in 10 cases.
19725832 2010 N-CAM dysfunction and unexpected accumulation of PSA-NCAM in brain of adult-onset autosomal-dominant leukodystrophy.
More...