Property Summary

Ligand Count 9
NCBI Gene PubMed Count 50
PubMed Score 775.04
PubTator Score 567.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
hereditary spastic paraplegia 318 0.0 4.0

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -1.300 1.4e-05
Astrocytoma, Pilocytic -1.900 2.8e-03
atypical teratoid / rhabdoid tumor -1.300 5.8e-04
Down syndrome 1.300 8.3e-03
ependymoma -2.400 1.4e-10
glioblastoma -1.700 1.6e-03
group 4 medulloblastoma -2.400 3.3e-03
medulloblastoma, large-cell -1.400 1.1e-03
oligodendroglioma -1.600 9.5e-07
pediatric high grade glioma -2.100 1.5e-03
Pick disease -1.500 1.7e-02
progressive supranuclear palsy -1.500 2.9e-02
psoriasis -1.800 6.0e-20
subependymal giant cell astrocytoma -4.272 1.9e-03

Protein-protein Interaction (4)

Gene RIF (22)

AA Sequence

MIFLTALPLFWIMISASRGGHWGAWMPSSISAFEGTCVSIPCRFDFPDELRPAVVHGVWYFNSPYPKNYP      1 - 70
PVVFKSRTQVVHESFQGRSRLLGDLGLRNCTLLLSNVSPELGGKYYFRGDLGGYNQYTFSEHSVLDIVNT     71 - 140
PNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTREA    141 - 210
NGHRLGCQASFPNTTLQFEGYASMDVKYPPVIVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGTVL    211 - 280
REAVAESLLLELEEVTPAEDGVYACLAENAYGQDNRTVGLSVMYAPWKPTVNGTMVAVEGETVSILCSTQ    281 - 350
SNPDPILTIFKEKQILSTVIYESELQLELPAVSPEDDGEYWCVAENQYGQRATAFNLSVEFAPVLLLESH    351 - 420
CAAARDTVQCLCVVKSNPEPSVAFELPSRNVTVNESEREFVYSERSGLVLTSILTLRGQAQAPPRVICTA    421 - 490
RNLYGAKSLELPFQGAHRLMWAKIGPVGAVVAFAILIAIVCYITQTRRKKNVTESPSFSAGDNPPVLFSS    491 - 560
DFRISGAPEKYESERRLGSERRLLGLRGEPPELDLSYSHSDLGKRPTKDSYTLTEELAEYAEIRVK        561 - 626
//

Text Mined References (54)

PMID Year Title