Property Summary

NCBI Gene PubMed Count 48
PubMed Score 37.72
PubTator Score 32.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
Astrocytoma, Pilocytic 3081 8.2e-07
ovarian cancer 8520 6.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Stickler syndrome 13 5.446 2.7

Expression

  Differential Expression (2)

Disease log2 FC p
Astrocytoma, Pilocytic 2.600 8.2e-07
ovarian cancer 1.600 6.7e-03

Protein-protein Interaction (6)

Gene RIF (25)

AA Sequence

MKTCWKIPVFFFVCSFLEPWASAAVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAAS      1 - 70
RRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQIQDSSGKE     71 - 140
QVGIKINGQTQSVVFSYKGLDGSLQTAAFSNLSSLFDSQWHKIMIGVERSSATLFVDCNRIESLPIKPRG    141 - 210
PIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPPGPP    211 - 280
GPPGVPGIDGIDGDRGPKGPPGPPGPAGEPGKPGAPGKPGTPGADGLTGPDGSPGSIGSKGQKGEPGVPG    281 - 350
SRGFPGRGIPGPPGPPGTAGLPGELGRVGPVGDPGRRGPPGPPGPPGPRGTIGFHDGDPLCPNACPPGRS    351 - 420
GYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQGELGEVGAQGPPGAQGLRGITGIVGDKGEKGARGLDG    421 - 490
EPGPQGLPGAPGDQGQRGPPGEAGPKGDRGAEGARGIPGLPGPKGDTGLPGVDGRDGIPGMPGTKGEPGK    491 - 560
PGPPGDAGLQGLPGVPGIPGAKGVAGEKGSTGAPGKPGQMGNSGKPGQQGPPGEVGPRGPQGLPGSRGEL    561 - 630
GPVGSPGLPGKLGSLGSPGLPGLPGPPGLPGMKGDRGVVGEPGPKGEQGASGEEGEAGERGELGDIGLPG    631 - 700
PKGSAGNPGEPGLRGPEGSRGLPGVEGPRGPPGPRGVQGEQGATGLPGVQGPPGRAPTDQHIKQVCMRVI    701 - 770
QEHFAEMAASLKRPDSGATGLPGRPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEK    771 - 840
GERGPPGRGPNGLPGAIGLPGDPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPGLPGFCEPASCTMQA    841 - 910
GQRAFNKGPDP                                                               911 - 921
//

Text Mined References (46)

PMID Year Title