Property Summary

NCBI Gene PubMed Count 379
Grant Count 285
R01 Count 170
Funding $27,942,349.6
PubMed Score 651.38
PubTator Score 726.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.093 0.000

Synonym

Accession P20823 A5Z2R8 E0YMJ5 E0YMK0 E0YMK1 E2I9R4 E2I9R5 F5H5U3 Q2M3H2 Q99861 HNF-1-alpha
Symbols HNF1
LFB1
TCF1
MODY3
TCF-1
HNF-1A
IDDM20

Gene

PANTHER Protein Class (1)

PDB

1IC8   2GYP  

Gene RIF (332)

PMID Text
26855178 These data suggest that HNF1 plays an important role in regulating intestinal epithelial cell function, both directly and through interactions with other intestinal transcription factors.
26776850 Hepatocellular adenomas, specifically the HNF1-alpha subtype, can cause false-positive PET findings when seeking to identify malignancy.
26714756 TCF-1 expression was lower in T cells from multiple sclerosis patients compared to healthy individuals.
26549228 AES is a transcriptional repressor for HNF-1-alpha in pancreatic beta-cell.
26446475 rejected the hypothesis that all human MODY-associated mutations in HNF1A / HNF4A induce changes in the pharmacokinetics of sulfonylureas in humans analogically to the Hnf1a(-/-) mouse model
26436572 HNF-1alpha gene p379fsinsC mutation is described in a Chinese family with maturity-onset diabetes of the young type 3.
26274031 Case Report: composite focal nodular hyperplasia and hepatocellular adenoma, arising in a woman with multiple HNF1A-inactivated adenomas.
26240958 DR of any degree was not present in our GCK-MODY group, while in spite of young age almost every fourth subject with HNF1A-MODY showed signs of this complication.
26221053 a pathway in which TNFalpha-NF-kappaB signaling switches off negative regulation by suppressing HNF-1alpha-mediated expression of miR-194, revealing insight into the mechanisms linking inflammatory pathways, miRNA, and HCC metastasis.
26174136 rs1169288 in HNF1A significantly associates with alpha-1 antitrypsin levels.
More...

AA Sequence

MVSKLSQLQTELLAALLESGLSKEALIQALGEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGS      1 - 70
EDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLN     71 - 140
QSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPAS    141 - 210
QQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHK    211 - 280
LAMDTYSGPPPGPGPGPALPAHSSPGLPPPALSPSKVHGVRYGQPATSETAEVPSSSGGPLVTVSTPLHQ    281 - 350
VSPTGLEPSHSLLSTEAKLVSAAGGPLPPVSTLTALHSLEQTSPGLNQQPQNLIMASLPGVMTIGPGEPA    351 - 420
SLGPTFTNTGASTLVIGLASTQAQSVPVINSMGSSLTTLQPVQFSQPLHPSYQQPLMPPVQSHVTQSPFM    421 - 490
ATMAQLQSPHALYSHKPEVAQYTHTGLLPQTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPAS    491 - 560
QATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQSSDSSNGQSHLLPSNHSVIETFISTQMASSS    561 - 630
Q//

Text Mined References (383)

PMID Year Title
26855178 2016 Hepatocyte nuclear factor 1 coordinates multiple processes in a model of intestinal epithelial cell function.
26776850 2016 PET-avid hepatocellular adenomas: incidental findings associated with HNF1-? mutated lesions.
26714756 2015 Identification of a novel mechanism of action of fingolimod (FTY720) on human effector T cell function through TCF-1 upregulation.
26549228 2015 Repression of HNF1?-mediated transcription by amino-terminal enhancer of split (AES).
26446475 2015 Half-Life of Sulfonylureas in HNF1A and HNF4A Human MODY Patients is not Prolonged as Suggested by the Mouse Hnf1a(-/-) Model.
26436572 2015 Hepatocyte nuclear factor-? genetic mutation in a Chinese pedigree with maturity-onset diabetes of the young (MODY3).
26274031 2015 Simultaneous occurrence of focal nodular hyperplasia and HNF1A-inactivated hepatocellular adenoma: a collision tumor simulating a composite FNH-HCA.
26240958 2015 Prevalence of Retinopathy in Adult Patients with GCK-MODY and HNF1A-MODY.
26221053 2015 NF-?B signaling relieves negative regulation by miR-194 in hepatocellular carcinoma by suppressing the transcription factor HNF-1?.
26174136 2015 Three missense variants of metabolic syndrome-related genes are associated with alpha-1 antitrypsin levels.
More...