Property Summary

NCBI Gene PubMed Count 405
PubMed Score 680.87
PubTator Score 726.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count P-value
osteosarcoma 7950 1.1e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Liver cancer 604 0.0 1.4
Disease Target Count Z-score Confidence
Hyperinsulinemic hypoglycemia 17 0.0 5.0
Type 1 diabetes mellitus 109 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1728 5.419 2.7
Disease Target Count Z-score Confidence
Adenoma 167 3.773 1.9
Cancer 2499 3.706 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.093 1.1e-05

Gene RIF (356)

AA Sequence

MVSKLSQLQTELLAALLESGLSKEALIQALGEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGS      1 - 70
EDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLN     71 - 140
QSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPAS    141 - 210
QQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHK    211 - 280
LAMDTYSGPPPGPGPGPALPAHSSPGLPPPALSPSKVHGVRYGQPATSETAEVPSSSGGPLVTVSTPLHQ    281 - 350
VSPTGLEPSHSLLSTEAKLVSAAGGPLPPVSTLTALHSLEQTSPGLNQQPQNLIMASLPGVMTIGPGEPA    351 - 420
SLGPTFTNTGASTLVIGLASTQAQSVPVINSMGSSLTTLQPVQFSQPLHPSYQQPLMPPVQSHVTQSPFM    421 - 490
ATMAQLQSPHALYSHKPEVAQYTHTGLLPQTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPAS    491 - 560
QATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQSSDSSNGQSHLLPSNHSVIETFISTQMASSS    561 - 630
Q//

Text Mined References (409)

PMID Year Title