Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.32
PubTator Score 3.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.600 1.2e-08
colon cancer 1.200 8.7e-03
invasive ductal carcinoma 1.900 4.6e-03
lung adenocarcinoma 2.100 6.9e-09
lung cancer 1.900 1.1e-04
non-small cell lung carcinoma 1.400 6.5e-21

Gene RIF (4)

AA Sequence

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK               71 - 130
//

Text Mined References (41)

PMID Year Title