Property Summary

NCBI Gene PubMed Count 40
PubMed Score 417.40
PubTator Score 180.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Breast cancer 1.400 1.9e-05
cutaneous lupus erythematosus 3.600 2.7e-06
cystic fibrosis 1.483 4.5e-03
dermatomyositis 1.400 1.2e-02
group 3 medulloblastoma -1.100 3.1e-03
interstitial cystitis 1.600 4.2e-04
intraductal papillary-mucinous adenoma (... 1.300 2.8e-02
intraductal papillary-mucinous carcinoma... 1.300 4.1e-02
intraductal papillary-mucinous neoplasm ... 2.900 2.9e-04
juvenile dermatomyositis 2.495 3.0e-21
lung cancer -1.300 1.5e-03
lung carcinoma -2.200 3.3e-13
malignant mesothelioma 3.800 7.0e-09
Multiple Sclerosis 1.700 7.6e-03
ovarian cancer 2.300 3.6e-04
pancreatic cancer 1.300 5.1e-05
psoriasis 1.300 6.6e-05
subependymal giant cell astrocytoma 1.889 1.2e-03
ulcerative colitis 2.000 5.3e-05

Gene RIF (56)

AA Sequence

MSKAHKPWPYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNN      1 - 70
QPPPGNRSQPRAMGPENNLYSQYEQKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSG     71 - 140
VALPRGSGIVTRCPLVLKLKKQPCEAWAGRISYRNTELELQDPGQVEKEIHKAQNVMAGNGRGISHELIS    141 - 210
LEITSPEVPDLTIIDLPGITRVAVDNQPRDIGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAH    211 - 280
EVDPEGDRTIGILTKPDLMDRGTEKSVMNVVRNLTYPLKKGYMIVKCRGQQEITNRLSLAEATKKEITFF    281 - 350
QTHPYFRVLLEEGSATVPRLAERLTTELIMHIQKSLPLLEGQIRESHQKATEELRRCGADIPSQEADKMF    351 - 420
FLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILATNTQKVKNIIHEEVEKYEKQYRGK    421 - 490
ELLGFVNYKTFEIIVHQYIQQLVEPALSMLQKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKH    491 - 560
TAKAENMIQLQFRMEQMVFCQDQIYSVVLKKVREEIFNPLGTPSQNMKLNSHFPSNESSVSSFTEIGIHL    561 - 630
NAYFLETSKRLANQIPFIIQYFMLRENGDSLQKAMMQILQEKNRYSWLLQEQSETATKRRILKERIYRLT    631 - 700
QARHALCQFSSKEIH                                                           701 - 715
//

Text Mined References (43)

PMID Year Title