Property Summary

NCBI Gene PubMed Count 39
Grant Count 18
R01 Count 8
Funding $1,608,447.54
PubMed Score 396.77
PubTator Score 180.60

Knowledge Summary

Patent

No data available

Expression

Gene RIF (80)

PMID Text
26719253 These experiments suggested that MxB does not contribute to the HIV-1 restriction observed in IFN-alpha-treated human cells.
26609934 Together, the data demonstrate that interferon-beta inhibits foamy virus early in infection and that MxB is not a restriction factor of foamy virus.
26446602 We propose that lower-order oligomerization of MX2 is sufficient for the effective inhibition of human immunodeficiency virus type 1.
26116899 CA-NC complex/core (in vitro-assembled from HIV-1 NL4-3 Gag amino acids 133-433; fusion protein) DOES NOT bind to MX2 (MxB) with mutations in interface 2 (Q644D, M574D, Y651D and M574D/Y651D, each preventing MX2 oligomerization)
26116899 CA-NC complex/core (in vitro-assembled from HIV-1 NL4-3 Gag amino acids 133-433; fusion protein) DOES NOT bind to MX2 (MxB) with mutations in interface 2 (Q644D, M574D, Y651D and M574D/Y651D, each preventing MX2 oligomerization)
26063425 CA-NC complex/core (in vitro-assembled from HIV-1 NL4-3 Gag amino acids 133-433; fusion protein) DOES NOT bind to MX2 (MxB) with mutations in interface 2 (Q644D, M574D, Y651D and M574D/Y651D, each preventing MX2 oligomerization)
26063425 CA-NC complex/core (in vitro-assembled from HIV-1 NL4-3 Gag amino acids 133-433; fusion protein) DOES NOT bind to MX2 (MxB) with mutations in interface 2 (Q644D, M574D, Y651D and M574D/Y651D, each preventing MX2 oligomerization)
25731773 CA-NC complex/core (in vitro-assembled from HIV-1 NL4-3 Gag amino acids 133-433; fusion protein) DOES NOT bind to MX2 (MxB) with mutations in interface 2 (Q644D, M574D, Y651D and M574D/Y651D, each preventing MX2 oligomerization)
25731773 CA-NC complex/core (in vitro-assembled from HIV-1 NL4-3 Gag amino acids 133-433; fusion protein) DOES NOT bind to MX2 (MxB) with mutations in interface 2 (Q644D, M574D, Y651D and M574D/Y651D, each preventing MX2 oligomerization)
25673704 A triple-arginine motif in the amino-terminal domain and oligomerization are required for HIV-1 inhibition by human MX2.
More...

AA Sequence

MSKAHKPWPYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNN      1 - 70
QPPPGNRSQPRAMGPENNLYSQYEQKVRPCIDLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSG     71 - 140
VALPRGSGIVTRCPLVLKLKKQPCEAWAGRISYRNTELELQDPGQVEKEIHKAQNVMAGNGRGISHELIS    141 - 210
LEITSPEVPDLTIIDLPGITRVAVDNQPRDIGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAH    211 - 280
EVDPEGDRTIGILTKPDLMDRGTEKSVMNVVRNLTYPLKKGYMIVKCRGQQEITNRLSLAEATKKEITFF    281 - 350
QTHPYFRVLLEEGSATVPRLAERLTTELIMHIQKSLPLLEGQIRESHQKATEELRRCGADIPSQEADKMF    351 - 420
FLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILATNTQKVKNIIHEEVEKYEKQYRGK    421 - 490
ELLGFVNYKTFEIIVHQYIQQLVEPALSMLQKAMEIIQQAFINVAKKHFGEFFNLNQTVQSTIEDIKVKH    491 - 560
TAKAENMIQLQFRMEQMVFCQDQIYSVVLKKVREEIFNPLGTPSQNMKLNSHFPSNESSVSSFTEIGIHL    561 - 630
NAYFLETSKRLANQIPFIIQYFMLRENGDSLQKAMMQILQEKNRYSWLLQEQSETATKRRILKERIYRLT    631 - 700
QARHALCQFSSKEIH                                                           701 - 715
//

Text Mined References (42)

PMID Year Title
26719253 2015 MxB Is Not Responsible for the Blocking of HIV-1 Infection Observed in Alpha Interferon-Treated Cells.
26609934 2016 Interferon but not MxB inhibits foamy retroviruses.
26446602 2015 Oligomerization Requirements for MX2-Mediated Suppression of HIV-1 Infection.
25673704 2015 A triple-arginine motif in the amino-terminal domain and oligomerization are required for HIV-1 inhibition by human MX2.
25571928 2015 The highly polymorphic cyclophilin A-binding loop in HIV-1 capsid modulates viral resistance to MxB.
25568212 2015 Contribution of MxB oligomerization to HIV-1 capsid binding and restriction.
25562491 2015 Mx2 expression is associated with reduced susceptibility to HIV infection in highly exposed HIV seronegative Kenyan sex workers.
25446123 2015 Structural insight into the assembly of human anti-HIV dynamin-like protein MxB/Mx2.
25416956 2014 A proteome-scale map of the human interactome network.
25363729 2014 Characterization of the amino-terminal domain of Mx2/MxB-dependent interaction with the HIV-1 capsid.
More...