Property Summary

NCBI Gene PubMed Count 85
Grant Count 384
R01 Count 247
Funding $41,239,721.55
PubMed Score 256.66
PubTator Score 122.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.100 0.003

Synonym

Accession P20585 A1L480 A1L482 A6NMM6 Q6PJT5 Q86UQ6 Q92867 hMSH3
Symbols DUP
FAP4
MRP1

Gene

PDB

3THW   3THX   3THY   3THZ  

Gene RIF (64)

PMID Text
26617824 Our meta-analysis results demonstrated that MSH3 rs26279 G > A polymorphism is associated with an increased risk of overall cancer, especially for the colorectal cancer and breast cancer.
26212458 The mismatch-binding protein MutS beta, a heterodimer of MSH2 and MSH3, activates ATR in response to DNA double-strand breaks.
25966119 Data show that single nucleotide polymorphisms in MutS homolog 3 (MSH3) had an impact on the chemotherapy response and prognosis of advanced non-small cell lung cancer (NCSLC) patients who were treated with platinum-based chemotherapy.
25598504 Our data present, for the first time, evidence that inherited MLH1 c.-93G>A, MSH2 c.211 + 9C>G, MSH3 c.3133G>A, and EXO1 c.1765G>A abnormalities of DNA MMR pathway are important determinants of head and neck squamous cell carcinoma
25461668 IL6 signaling disrupts the nuclear localization of hMSH3 and DNA repair, leading to elevated microsatellite alterations at selected tetranucleotide repeats in cancer cell lines.
24934723 Methylation of MSH3 together with exposure to tobacco smoke is involved in esophageal carcinogenesis.
23724141 MSH3 status can regulate the DNA damage response and extent of apoptosis induced by chemotherapy.
23339595 Single nucleotide polymorphisms in MSH3 are associated with myelodysplastic syndromes.
23226332 Oxidative stress, which causes a shift of hMSH3's subcellular location, may contribute to an hMSH3 loss-of-function phenotype by sequestering it to the cytosol
22941650 siRNA knockdown of the MutSbeta subunits MSH2 or MSH3 impeded expansion of threshold-length CTG*CAG repeats.
More...

AA Sequence

MSRRKPASGGLAASSSAPARQAVLSRFFQSTGSLKSTSSSTGAADQVDPGAAAAAAAAAAAAPPAPPAPA      1 - 70
FPPQLPPHIATEIDRRKKRPLENDGPVKKKVKKVQQKEGGSDLGMSGNSEPKKCLRTRNVSKSLEKLKEF     71 - 140
CCDSALPQSRVQTESLQERFAVLPKCTDFDDISLLHAKNAVSSEDSKRQINQKDTTLFDLSQFGSSNTSH    141 - 210
ENLQKTASKSANKRSKSIYTPLELQYIEMKQQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNF    211 - 280
MTASIPTHRLFVHVRRLVAKGYKVGVVKQTETAALKAIGDNRSSLFSRKLTALYTKSTLIGEDVNPLIKL    281 - 350
DDAVNVDEIMTDTSTSYLLCISENKENVRDKKKGNIFIGIVGVQPATGEVVFDSFQDSASRSELETRMSS    351 - 420
LQPVELLLPSALSEQTEALIHRATSVSVQDDRIRVERMDNIYFEYSHAFQAVTEFYAKDTVDIKGSQIIS    421 - 490
GIVNLEKPVICSLAAIIKYLKEFNLEKMLSKPENFKQLSSKMEFMTINGTTLRNLEILQNQTDMKTKGSL    491 - 560
LWVLDHTKTSFGRRKLKKWVTQPLLKLREINARLDAVSEVLHSESSVFGQIENHLRKLPDIERGLCSIYH    561 - 630
KKCSTQEFFLIVKTLYHLKSEFQAIIPAVNSHIQSDLLRTVILEIPELLSPVEHYLKILNEQAAKVGDKT    631 - 700
ELFKDLSDFPLIKKRKDEIQGVIDEIRMHLQEIRKILKNPSAQYVTVSGQEFMIEIKNSAVSCIPTDWVK    701 - 770
VGSTKAVSRFHSPFIVENYRHLNQLREQLVLDCSAEWLDFLEKFSEHYHSLCKAVHHLATVDCIFSLAKV    771 - 840
AKQGDYCRPTVQEERKIVIKNGRHPVIDVLLGEQDQYVPNNTDLSEDSERVMIITGPNMGGKSSYIKQVA    841 - 910
LITIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGQSTFMEELTDTAEIIRKATSQSLVILDELGRG    911 - 980
TSTHDGIAIAYATLEYFIRDVKSLTLFVTHYPPVCELEKNYSHQVGNYHMGFLVSEDESKLDPGAAEQVP    981 - 1050
DFVTFLYQITRGIAARSYGLNVAKLADVPGEILKKAAHKSKELEGLINTKRKRLKYFAKLWTMHNAQDLQ   1051 - 1120
KWTEEFNMEETQTSLLH                                                        1121 - 1137
//

Text Mined References (90)

PMID Year Title
26617824 2015 MSH3 rs26279 polymorphism increases cancer risk: a meta-analysis.
26212458 2015 The Mismatch-Binding Factor MutS? Can Mediate ATR Activation in Response to DNA Double-Strand Breaks.
25966119 2015 Correlation of MSH3 polymorphisms with response and survival in advanced non-small cell lung cancer patients treated with first-line platinum-based chemotherapy.
25598504 2015 Association between genetic polymorphisms in DNA mismatch repair-related genes with risk and prognosis of head and neck squamous cell carcinoma.
25461668 2015 Interleukin 6 alters localization of hMSH3, leading to DNA mismatch repair defects in colorectal cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24934723 2014 Aberrant methylation of the MSH3 promoter and distal enhancer in esophageal cancer patients exposed to first-hand tobacco smoke.
23724141 2013 MSH3 mismatch repair protein regulates sensitivity to cytotoxic drugs and a histone deacetylase inhibitor in human colon carcinoma cells.
23339595 2013 DNA repair gene variants are associated with an increased risk of myelodysplastic syndromes in a Czech population.
23226332 2012 Oxidative stress induces nuclear-to-cytosol shift of hMSH3, a potential mechanism for EMAST in colorectal cancer cells.
More...