Property Summary

NCBI Gene PubMed Count 68
PubMed Score 75.30
PubTator Score 79.68

Knowledge Summary

Patent (5,540)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 7.6504857625427E-9
posterior fossa group B ependymoma 1530 3.88827463138853E-8
tuberculosis and treatment for 6 months 686 5.66894005564024E-7
atypical teratoid/rhabdoid tumor 1095 6.54888736159004E-7
osteosarcoma 7933 1.02521602370603E-4
breast carcinoma 1614 2.07600345634365E-4
adrenocortical carcinoma 1427 4.53740736174033E-4
group 3 medulloblastoma 2254 5.30674794503977E-4
cutaneous lupus erythematosus 1056 0.0026933094590954
invasive ductal carcinoma 2950 0.00331550973934089
primitive neuroectodermal tumor 3031 0.00333700479823569
ductal carcinoma in situ 1745 0.00380748940728961
Atopic dermatitis 944 0.0188309896736146
subependymal giant cell astrocytoma 2287 0.0232991924596539
spina bifida 1064 0.0412572915265152

Expression

Synonym

Accession P20393 Q0P5Z4 Q15304
Symbols EAR1
hRev
THRA1
THRAL
ear-1

Gene

PDB

3N00   1A6Y   1EF6   1GA5   1HLZ  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (50)

PMID Text
26392558 Data show that ubiquitin E3 ligase Siah2 depletion delays circadian degradation of nuclear hormone receptor RevErbalpha (Nr1d1) and lengthens period length.
25969949 Highly quantitative fluorescence anisotropy assays in competition mode revealed that the rev-erbA-alpha specificity for the NCoR corepressor lies in the first two residues of the beta-strand in Interaction Domain 1 of NCoR.
25798852 the role of NR1D1 polymorphisms in the regulation of Nuclear receptor REV-ERBalpha and circadian rhythms regulation
25789810 associations between NR1D1, RORA and RORB genes and bipolar disorder.(
25365257 CRY2 and REV-ERB ALPHA as the clock genes upregulated in obesity during the 24 h period and that REV-ERB ALPHA is an important gene associated with MS.
25089907 Our results suggest that the REV-ERB ALPHA rs939347 polymorphism could modulate body fat mass in men. The present work supports the role of REV-ERB ALPHA in the development of obesity as well as a potential target for the treatment of obesity
24677802 Using free-energy simulations, the study shows that rev-erbA-alpha-induced DNA deformation preferentially occurs by induced fit rather than by conformational selection, even though the DNA is only slightly distorted in the complex.
24497272 Rev-erbalpha is a novel regulator of hepatic stellate cell transdifferentation
24311788 apoA-IV inhibits hepatic gluconeogenesis by decreasing Glc-6-Pase and PEPCK gene expression through NR1D1.
23449984 Rev-erbalpha bestows protection against mycobacterial infection by direct gene repression of IL10 and thus provide a novel target in modulating macrophage microbicidal properties.
More...

AA Sequence

MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGS      1 - 70
IPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTSNITKLNGMVLLCKVCGDVAS     71 - 140
GFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPK    141 - 210
REKQRMLAEMQSAMNLANNQLSSQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPS    211 - 280
PEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQR    281 - 350
HNEALNGLRQAPSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPM    351 - 420
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNV    421 - 490
KDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSASVE    491 - 560
QLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ                    561 - 614
//

Text Mined References (76)

PMID Year Title
26392558 2015 Ubiquitin ligase Siah2 regulates RevErb? degradation and the mammalian circadian clock.
25969949 2015 Molecular mechanisms of transcriptional control by Rev-erb?: An energetic foundation for reconciling structure and binding with biological function.
25798852 2015 Associations between polymorphisms in the NR1D1 gene encoding for nuclear receptor REV-ERB? and circadian typologies.
25789810 2015 Investigation of associations between NR1D1, RORA and RORB genes and bipolar disorder.
25365257 2014 Altered clock gene expression in obese visceral adipose tissue is associated with metabolic syndrome.
25089907 2014 REV-ERB ALPHA polymorphism is associated with obesity in the Spanish obese male population.
24677802 2014 RevErb? preferentially deforms DNA by induced fit.
24497272 2014 Novel role of nuclear receptor Rev-erb? in hepatic stellate cell activation: potential therapeutic target for liver injury.
24415752 2014 Deleted in breast cancer 1 (DBC1) protein regulates hepatic gluconeogenesis.
24311788 2014 Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1.
More...