Tbio | L-serine dehydratase/L-threonine deaminase |
This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. The encoded protein can also metabolize threonine to NH4+ and 2-ketobutyrate. The encoded protein is found predominantly in the liver. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
group 4 medulloblastoma | 1875 | 4.24434676717716E-7 |
posterior fossa group B ependymoma | 1530 | 1.48041272795656E-6 |
medulloblastoma, large-cell | 6234 | 3.25747727910219E-6 |
atypical teratoid / rhabdoid tumor | 4369 | 1.69343529059348E-5 |
tuberculosis | 1563 | 2.09689998750759E-5 |
primitive neuroectodermal tumor | 3031 | 3.58535994753627E-5 |
adult high grade glioma | 2148 | 2.27799946461612E-4 |
invasive ductal carcinoma | 2950 | 3.14621509140684E-4 |
adrenocortical carcinoma | 1427 | 0.0126099963913837 |
inflammatory breast cancer | 404 | 0.0167643657878978 |
pancreatic ductal adenocarcinoma liver metastasis | 1795 | 0.0168970958430469 |
osteosarcoma | 7933 | 0.0259435917765803 |
adrenocortical adenoma | 134 | 0.0329287645218341 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Hypervitaminosis A | 8 | 3.495 | 1.7 |
Sly syndrome | 4 | 3.429 | 1.7 |
Disease | log2 FC | p |
---|---|---|
osteosarcoma | 1.135 | 0.026 |
posterior fossa group B ependymoma | -1.300 | 0.000 |
group 4 medulloblastoma | -1.600 | 0.000 |
atypical teratoid / rhabdoid tumor | -1.300 | 0.000 |
medulloblastoma, large-cell | -1.600 | 0.000 |
primitive neuroectodermal tumor | -1.400 | 0.000 |
adrenocortical adenoma | -1.108 | 0.033 |
adrenocortical carcinoma | -1.172 | 0.013 |
tuberculosis | -1.100 | 0.000 |
pancreatic ductal adenocarcinoma liver m... | -2.132 | 0.017 |
adult high grade glioma | -1.400 | 0.000 |
invasive ductal carcinoma | 2.197 | 0.000 |
inflammatory breast cancer | 1.300 | 0.017 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA Inparanoid |
S.cerevisiae | OMA EggNOG |
MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGM 1 - 70 AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPL 71 - 140 IWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKL 141 - 210 VSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSH 211 - 280 VIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGMTNRLPK 281 - 328 //
PMID | Year | Title |
---|---|---|
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
23112234 | 2012 | Modulating the function of human serine racemase and human serine dehydratase by protein engineering. |
18342636 | 2008 | A catalytic mechanism that explains a low catalytic activity of serine dehydratase like-1 from human cancer cells: crystal structure and site-directed mutagenesis studies. |
18289528 | 2008 | Association between sorbitol dehydrogenase gene polymorphisms and type 2 diabetic retinopathy. |
18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. |
15689518 | 2005 | Crystal structure of the pyridoxal-5'-phosphate-dependent serine dehydratase from human liver. |
14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
14646100 | 2003 | Crystallization and preliminary crystallographic analysis of human serine dehydratase. |
12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |
10347152 | 1999 | Flux of the L-serine metabolism in rabbit, human, and dog livers. Substantial contributions of both mitochondrial and peroxisomal serine:pyruvate/alanine:glyoxylate aminotransferase. |
More... |