Property Summary

NCBI Gene PubMed Count 16
PubMed Score 195.81
PubTator Score 242.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical adenoma -1.108 3.3e-02
adrenocortical carcinoma -1.172 1.3e-02
adult high grade glioma -1.400 2.3e-04
atypical teratoid / rhabdoid tumor -1.300 1.7e-05
ependymoma -1.200 3.9e-07
group 4 medulloblastoma -1.600 4.2e-07
inflammatory breast cancer 1.300 1.7e-02
invasive ductal carcinoma 2.197 3.1e-04
medulloblastoma, large-cell -1.600 3.3e-06
osteosarcoma 1.013 2.5e-04
pancreatic ductal adenocarcinoma liver m... -2.132 1.7e-02
primitive neuroectodermal tumor -1.400 3.6e-05
tuberculosis -1.100 2.1e-05

Synonym

Accession P20132 A8K9P5 SDH
Symbols SDH

Gene

SDS

PANTHER Protein Class (2)

PDB

1P5J   4H27  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGM      1 - 70
AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPL     71 - 140
IWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKL    141 - 210
VSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSH    211 - 280
VIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGMTNRLPK                          281 - 328
//

Text Mined References (17)

PMID Year Title