Property Summary

NCBI Gene PubMed Count 15
PubMed Score 192.67
PubTator Score 242.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
group 4 medulloblastoma 1875 4.24434676717716E-7
posterior fossa group B ependymoma 1530 1.48041272795656E-6
medulloblastoma, large-cell 6234 3.25747727910219E-6
atypical teratoid / rhabdoid tumor 4369 1.69343529059348E-5
tuberculosis 1563 2.09689998750759E-5
primitive neuroectodermal tumor 3031 3.58535994753627E-5
adult high grade glioma 2148 2.27799946461612E-4
invasive ductal carcinoma 2950 3.14621509140684E-4
adrenocortical carcinoma 1427 0.0126099963913837
inflammatory breast cancer 404 0.0167643657878978
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0168970958430469
osteosarcoma 7933 0.0259435917765803
adrenocortical adenoma 134 0.0329287645218341
Disease Target Count Z-score Confidence
Hypervitaminosis A 8 3.495 1.7
Sly syndrome 4 3.429 1.7

Expression

Synonym

Accession P20132 A8K9P5 SDH
Symbols SDH

Gene

SDS

PANTHER Protein Class (2)

PDB

1P5J   4H27  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (2)

PMID Text
23112234 S84A serine racemase mutant behaved like serine dehydratase, whereas A65S serine dehydratase mutant acquired an additional function of using D-serine as a substrate.
18289528 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGM      1 - 70
AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPL     71 - 140
IWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKL    141 - 210
VSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSH    211 - 280
VIQKLQLEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGMTNRLPK                          281 - 328
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23112234 2012 Modulating the function of human serine racemase and human serine dehydratase by protein engineering.
18342636 2008 A catalytic mechanism that explains a low catalytic activity of serine dehydratase like-1 from human cancer cells: crystal structure and site-directed mutagenesis studies.
18289528 2008 Association between sorbitol dehydrogenase gene polymorphisms and type 2 diabetic retinopathy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15689518 2005 Crystal structure of the pyridoxal-5'-phosphate-dependent serine dehydratase from human liver.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14646100 2003 Crystallization and preliminary crystallographic analysis of human serine dehydratase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10347152 1999 Flux of the L-serine metabolism in rabbit, human, and dog livers. Substantial contributions of both mitochondrial and peroxisomal serine:pyruvate/alanine:glyoxylate aminotransferase.
More...