Property Summary

NCBI Gene PubMed Count 1,024
Grant Count 230
R01 Count 116
Funding $24,175,006.89
PubMed Score 939.13
PubTator Score 1263.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma -1.564 0.000
group 3 medulloblastoma 1.200 0.001
lung carcinoma 1.200 0.000

Synonym

Accession P18887 Q6IBS4 Q9HCB1
Symbols RCC

Gene

PDB

2W3O   1CDZ   1XNA   1XNT   2D8M   3K75   3K77   3LQC   5E6Q  

 GO Component (2)

Gene RIF (1156)

PMID Text
27393451 was seen that the score was significantly higher in GG genotypes thereby corroborating the role of the polymorphism XRCC1 Arg399Gln
27166553 XRCC1 SNPs are associated with acute coronary syndromes in patients from Pakistan.
26909965 The XRCC1 194 (Arg>Trp) polymorphism was correlated with a better response to chemotherapy and a low risk of death in patients with gastric cancer.
26898429 The aim of this study was to investigate the association between polymorphisms of XRCC1 Arg399Gln, XRCC3 Thr241Met, and XPD Lys751Gln and laryngeal cancer risk.
26826460 Our results suggested that decreased XRCC1 expression levels might be associated with the increased risk of therapeutic IR-related acute side effects in patients with breast cancer.
26824244 the study indicates that the XRCC1 locus could be a potential candidate contributing to the pathogenesis of schizophrenia.
26823821 the GSTP1 Ile105Val and XRCC1 Arg194Trp were associated with better response to chemotherapy and longer survival of advanced non-small cell lung cancer
26723520 Arg194Trp SNP was associated with increased non-Hodgkin lymphoma (NHL) risk within the Asian population, and increased diffuse large B cell lymphoma (DLBCL) risk within the overall population; Arg399Gln SNP was associated with decreased risk for NHL and DLBCL; Arg280His SNP was not associated with NHL risk.[Meta-analysis]
26692147 Results show that XRCC1-Arg/Gln, XRCC1-Arg/His, and OGG1 A/G polymorphism have a role in the development of rheumatoid arthritis disease.
26681190 findings showed that the rs25487 and rs1799782 polymorphisms of XRCC1 may contribute to an individual's susceptibility to CBP and may be used as valid biomarkers
More...

AA Sequence

MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEV      1 - 70
LVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDS     71 - 140
PFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPS    141 - 210
YAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTR    211 - 280
TPATAPVPARAQGAVTGKPRGEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYR    281 - 350
PDWTRDSTHLICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSRRYLMAGPGSSSEEDEASHSGG    351 - 420
SGDEAPKLPQKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSEGQDNGAEDSGDTED    421 - 490
ELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELPDFFQGKHFFLYGEFPGDERR    491 - 560
KLIRYVTAFNGELEDNMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVV    561 - 630
PQA                                                                       631 - 633
//

Text Mined References (1039)

PMID Year Title
27393451 2016 Polymorphisms in DNA repair genes XRCC1 and OGG1 lead to the progression of rheumatoid arthritis in Pakistani patients.
27166553 2016 Association of Polymorphisms (rs 1799782, rs25489 and rs25487) in XRCC1 and (rs 13181) XPD genes with Acute Coronary Artery Syndrome in Subjects from Multan, Pakistan.
26909965 2016 Genetic variability of XRCC1 influences the treatment outcome of gastric cancer.
26898429 2016 Single nucleotide polymorphisms in DNA repair genes and the risk of laryngeal cancer: A meta-analysis.
26826460 2016 Decreased DNA repair gene XRCC1 expression is associated with radiotherapy-induced acute side effects in breast cancer patients.
26824244 2016 DNA Repair Gene (XRCC1) Polymorphism (Arg399Gln) Associated with Schizophrenia in South Indian Population: A Genotypic and Molecular Dynamics Study.
26823821 2015 Role of GSTP1 Ile105Val and XRCC1 Arg194Trp, Arg280His and Arg399Gln gene polymorphisms in the clinical outcome of advanced non-small cell lung cancer.
26723520 2016 Genetic polymorphisms in the DNA repair gene, XRCC1 associate with non-Hodgkin lymphoma susceptibility: A systematic review and meta-analysis.
26692147 2016 Association of XRCC1 and OGG1 DNA repair gene polymorphisms with rheumatoid arthritis in Egyptian patients.
26681190 2015 Genetic Polymorphisms in XRCC1, CD3EAP, PPP1R13L, XPB, XPC, and XPF and the Risk of Chronic Benzene Poisoning in a Chinese Occupational Population.
More...