Property Summary

Ligand Count 1
NCBI Gene PubMed Count 86
PubMed Score 233.92
PubTator Score 60.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma 1.405 9.7e-05
group 3 medulloblastoma 2.100 4.5e-06
malignant mesothelioma 1.400 1.2e-06
osteosarcoma -1.096 5.6e-03
primitive neuroectodermal tumor 1.100 2.4e-03

Protein-protein Interaction (1)

Gene RIF (60)

AA Sequence

MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKAARVLGSEGEE      1 - 70
EDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPKRRTARKQLPKRTIQEVLEEQ     71 - 140
SEDEDREAKRKKEEEEEETPKESLTEAEVATEKEGEDGDQPTTPPKPLKTSKAETPTESVSEPEVATKQE    141 - 210
LQEEEEQTKPPRRAPKTLSSFFTPRKPAVKKEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDAC    211 - 280
WKPGQKVPYLAVARTFEKIEEVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVG    281 - 350
DGVLLKAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST    351 - 420
AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAMVDAGKGKTAE    421 - 490
ARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPLKPMLAHPTRGISEVLKRFEE    491 - 560
AAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKK    561 - 630
QIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLD    631 - 700
TKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGK    701 - 770
RAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSA    771 - 840
VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGED    841 - 910
SGSDPEDTY                                                                 911 - 919
//

Text Mined References (98)

PMID Year Title