Property Summary

NCBI Gene PubMed Count 83
Grant Count 77
R01 Count 59
Funding $4,407,197.73
PubMed Score 229.06
PubTator Score 60.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma -1.096 0.006
group 3 medulloblastoma 2.100 0.000
primitive neuroectodermal tumor 1.100 0.002
adrenocortical carcinoma 1.405 0.000

Synonym

Accession P18858 B2RAI8 B4DTU4 Q2TB12 Q32P23
Symbols

Gene

PDB

1X9N  

Gene RIF (57)

PMID Text
26151554 Data suggest that DNA ligase I (LigI)-deficient 46BR.1G1 cells represent a model to investigate the biological effects of sub-lethal levels of DNA insults.
26125914 The LIG1 CC genotype was associated with susceptibility to non-small cell lung cancer, and the AA genotype demonstrated increased radiosensitivity compared to the AC and CC genotypes.
25879709 A novel method for monitoring functional lesion-specific recruitment of repair proteins in live cells.
25189241 Ppolymorphisms in LIG1 affect its expression and may therefore change its function.
24084463 there is no association between LIGI polymorphisms and cervical cancer risk. However, they may be playing an important role in modulating the risk of cervical adenocarcinoma in North Indian women
23620595 Data indicate that Ku70/Ku80 facilitates the cooperative binding of multiple XRCC4/Ligase IV (XL) and XLF molecules to DNA.
23339595 Single nucleotide polymorphisms in LIG1 are associated with myelodysplastic syndromes.
22952233 phosphorylation of serine 51 on hLigI plays a critical role in regulating the interaction between hLigI and RFC, which is required for efficient DNA replication and repair.
22918593 DNA ligase I also interacts with replication factor C, the factor that loads the PCNA trimeric ring onto DNA.
22139380 Data show that association of study-wide significance (P < 8.2 x 10(-5)) was identified for single-nucleotide polymorphisms (SNP) in TP53, LIG1, and BIK.
More...

AA Sequence

MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKAARVLGSEGEE      1 - 70
EDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPKRRTARKQLPKRTIQEVLEEQ     71 - 140
SEDEDREAKRKKEEEEEETPKESLTEAEVATEKEGEDGDQPTTPPKPLKTSKAETPTESVSEPEVATKQE    141 - 210
LQEEEEQTKPPRRAPKTLSSFFTPRKPAVKKEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDAC    211 - 280
WKPGQKVPYLAVARTFEKIEEVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVG    281 - 350
DGVLLKAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST    351 - 420
AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAMVDAGKGKTAE    421 - 490
ARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPLKPMLAHPTRGISEVLKRFEE    491 - 560
AAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKK    561 - 630
QIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLD    631 - 700
TKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGK    701 - 770
RAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSA    771 - 840
VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGED    841 - 910
SGSDPEDTY                                                                 911 - 919
//

Text Mined References (95)

PMID Year Title
26151554 2015 Chronic Replication Problems Impact Cell Morphology and Adhesion of DNA Ligase I Defective Cells.
26125914 2015 Relationship between genetic polymorphisms of DNA ligase 1 and non-small cell lung cancer susceptibility and radiosensitivity.
25879709 2015 A novel method for monitoring functional lesion-specific recruitment of repair proteins in live cells.
25189241 2014 LIG1 polymorphisms: the Indian scenario.
24911150 2014 Hypomorphic PCNA mutation underlies a human DNA repair disorder.
24084463 2013 Human DNA ligase i (ligi) gene and risk of cervical cancer in North Indian women.
23620595 2013 Cooperative assembly of a protein-DNA filament for nonhomologous end joining.
23339595 2013 DNA repair gene variants are associated with an increased risk of myelodysplastic syndromes in a Czech population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22952233 2012 Phosphorylation of serine 51 regulates the interaction of human DNA ligase I with replication factor C and its participation in DNA replication and repair.
More...