Property Summary

NCBI Gene PubMed Count 163
PubMed Score 465.83
PubTator Score 256.95

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 4.33870808640778E-14
non-small cell lung cancer 2798 4.86061046756411E-12
breast carcinoma 1614 5.96589308358602E-12
malignant mesothelioma 3163 3.05387811558262E-8
lung cancer 4473 1.77752959618048E-7
lung carcinoma 2844 1.27946236096156E-6
inflammatory breast cancer 404 1.48414175459197E-6
cystic fibrosis 1670 2.17941129090915E-6
pituitary cancer 1972 5.34234880247466E-5
lung adenocarcinoma 2714 1.75694163305719E-4
nephrosclerosis 329 1.81220820376913E-4
ovarian cancer 8492 2.539517588569E-4
tuberculosis and treatment for 3 months 327 8.86384078986032E-4
urothelial carcinoma 318 9.10135450157146E-4
hepatocellular carcinoma 550 0.00108296191398158
interstitial cystitis 2299 0.00148413266962414
group 4 medulloblastoma 1875 0.00225689337687251
adrenocortical carcinoma 1427 0.00293905468670985
glioblastoma 5572 0.00334669150687052
posterior fossa group A ependymoma 1511 0.00344743150120603
Bipolar Disorder 266 0.00797192382387258
chronic rhinosinusitis 512 0.0102130000030681
osteosarcoma 7933 0.0102813075467642
acute myeloid leukemia 785 0.0103709208562035
ulcerative colitis 2087 0.0127514353263248
invasive ductal carcinoma 2950 0.0184778098392594
Multiple myeloma 1328 0.0206098903827264
aldosterone-producing adenoma 664 0.0219203979655778
pterygium 74 0.0388597278663604
gastric carcinoma 832 0.0398779495328648
esophageal adenocarcinoma 737 0.0420857832755998
Disease Target Count Z-score Confidence
Cancer 2346 4.17 2.1
Neuropathy 210 3.276 1.6
Vascular disease 281 3.136 1.6


  Differential Expression (31)

Disease log2 FC p
nephrosclerosis -2.069 0.000
gastric carcinoma 2.700 0.040
hepatocellular carcinoma -1.300 0.001
Multiple myeloma 1.925 0.021
urothelial carcinoma -3.200 0.001
malignant mesothelioma 3.100 0.000
esophageal adenocarcinoma 1.900 0.042
glioblastoma 2.800 0.003
osteosarcoma 1.500 0.010
cystic fibrosis -1.646 0.000
adrenocortical carcinoma -1.987 0.003
tuberculosis and treatment for 3 months -1.500 0.001
non-small cell lung cancer -1.912 0.000
lung cancer -4.300 0.000
interstitial cystitis 1.700 0.001
group 4 medulloblastoma -2.000 0.002
posterior fossa group A ependymoma 1.500 0.003
aldosterone-producing adenoma -1.344 0.022
invasive ductal carcinoma -1.240 0.018
lung adenocarcinoma -1.719 0.000
psoriasis -3.300 0.000
inflammatory breast cancer -4.200 0.000
lung carcinoma -1.600 0.000
breast carcinoma -1.400 0.000
pterygium -2.300 0.039
Bipolar Disorder 1.297 0.008
acute myeloid leukemia 1.400 0.010
ulcerative colitis 2.100 0.013
ovarian cancer 2.900 0.000
pituitary cancer -2.900 0.000
chronic rhinosinusitis -1.808 0.010


PANTHER Protein Class (1)

  Ortholog (11)

Gene RIF (135)

26994140 As a result, ATF3 rather protected the p53 wild-type cells from UV-induced apoptosis. Our results thus indicate that ATF3 regulates cell fates upon UV irradiation in a p53-dependent manner.
26851004 ATF3 overexpression leads to an increase of collective cell invasion phenotype in Colorectal Cancer.
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26709509 TGRL lipolysis products induce stress protein ATF3 via the TGF-beta receptor pathway, resulting in induction of apoptosis in aortic endothelial cells
26418018 Data suggest that after the expression of activating transcription factor 3 (ATF3) and microRNA miR-30c-2-3p elicited by lysophosphatidic acid, miR-30c-2-3p negatively regulates the expression of ATF3 through post-transcriptional silencing.
26412238 Activating transcription factor 3 represses inflammatory responses by binding to the p65 subunit of NF-kappaB
26305977 The function of ATF3 is to block the reactivation of virus induced by neuronal stress.
26051724 Tissue array analysis suggests role for ATF3 in regulating the occurrence of glioma and disease progression.
25931127 Human CHAC1 Protein Degrades Glutathione, and mRNA Induction Is Regulated by the Transcription Factors ATF4 and ATF3 and a Bipartite ATF/CRE Regulatory Element.
25872784 Taken together, these results suggest that ATF3 promotes the progression of human gliomas

AA Sequence

HLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS                                 141 - 181

Text Mined References (165)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26994140 2016 The Stress-responsive Gene ATF3 Mediates Dichotomous UV Responses by Regulating the Tip60 and p53 Proteins.
26851004 2016 Potential Dual Role of Activating Transcription Factor 3 in Colorectal Cancer.
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26709509 2015 TGRL Lipolysis Products Induce Stress Protein ATF3 via the TGF-? Receptor Pathway in Human Aortic Endothelial Cells.
26418018 2015 Lysophosphatidic Acid Mediates Activating Transcription Factor 3 Expression Which Is a Target for Post-Transcriptional Silencing by miR-30c-2-3p.
26412238 2015 Activating transcription factor 3 represses inflammatory responses by binding to the p65 subunit of NF-?B.
26305977 2015 Role of activating transcription factor 3 in the synthesis of latency-associated transcript and maintenance of herpes simplex virus 1 in latent state in ganglia.
26051724 2015 The expression of ATF3, MMP-2 and maspin in tissue chip of glioma.
25931127 2015 Human CHAC1 Protein Degrades Glutathione, and mRNA Induction Is Regulated by the Transcription Factors ATF4 and ATF3 and a Bipartite ATF/CRE Regulatory Element.