Property Summary

NCBI Gene PubMed Count 178
PubMed Score 520.85
PubTator Score 256.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cancer 2499 4.255 2.1
Neuropathy 261 3.448 1.7
Vascular disease 319 3.166 1.6

Expression

  Differential Expression (31)

Disease log2 FC p
acute myeloid leukemia 1.200 2.7e-02
adrenocortical carcinoma -1.987 2.9e-03
aldosterone-producing adenoma -1.344 2.2e-02
Bipolar Disorder 1.297 8.0e-03
Breast cancer -2.600 2.3e-09
breast carcinoma -1.400 6.0e-12
chronic rhinosinusitis -1.808 1.0e-02
cystic fibrosis -1.646 2.2e-06
esophageal adenocarcinoma 1.900 4.2e-02
gastric cancer -1.400 4.2e-02
glioblastoma 2.800 3.3e-03
group 4 medulloblastoma -2.000 2.3e-03
hepatocellular carcinoma -1.300 1.1e-03
interstitial cystitis 1.700 1.5e-03
invasive ductal carcinoma -1.240 1.8e-02
lung adenocarcinoma -1.719 1.8e-04
lung cancer -3.600 5.0e-05
lung carcinoma -1.600 1.3e-06
malignant mesothelioma 3.100 3.1e-08
Multiple myeloma 1.925 2.1e-02
nephrosclerosis -2.069 1.8e-04
non-small cell lung cancer -1.205 1.5e-08
osteosarcoma 1.367 2.0e-02
ovarian cancer 1.100 4.8e-02
pituitary cancer -2.900 5.3e-05
posterior fossa group A ependymoma 1.500 3.4e-03
psoriasis -1.700 5.9e-05
pterygium -2.300 3.9e-02
tuberculosis -1.300 3.2e-02
ulcerative colitis 1.600 1.2e-02
urothelial carcinoma -1.400 5.0e-04

 IMPC Phenotype (1)

Gene RIF (149)

AA Sequence

MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDR      1 - 70
PLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQ     71 - 140
HLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS                                 141 - 181
//

Text Mined References (181)

PMID Year Title