Property Summary

NCBI Gene PubMed Count 16
PubMed Score 16.52
PubTator Score 25.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (3)

AA Sequence

MVRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRC      1 - 70
AQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYM     71 - 140
SSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLKKQKLMARE                              141 - 184
//

Text Mined References (21)

PMID Year Title