Property Summary

NCBI Gene PubMed Count 49
PubMed Score 197.61
PubTator Score 83.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession P18283 Q6PJ52 Q8WWI7 Q9NRP9 GPx-2
Symbols GPRP
GPx-2
GI-GPx
GPRP-2
GPx-GI
GSHPx-2
GSHPX-GI

Gene

PANTHER Protein Class (2)

PDB

2HE3  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (40)

AA Sequence

MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPCNQ      1 - 70
FGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLI     71 - 140
IWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI                        141 - 190
//

Text Mined References (51)

PMID Year Title