Property Summary

NCBI Gene PubMed Count 44
PubMed Score 190.49
PubTator Score 83.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.78604448767368E-20
non-small cell lung cancer 2798 2.96847955642868E-15
non-inflammatory breast cancer 208 1.92523916099808E-8
osteosarcoma 7933 8.52486648275131E-8
lung cancer 4473 4.96032319387215E-7
lung adenocarcinoma 2714 9.03208338255942E-6
primary pancreatic ductal adenocarcinoma 1271 9.55089695006529E-4
pancreatic cancer 2300 0.00117261253085545
interstitial cystitis 2299 0.00193357804296746
head and neck cancer and chronic obstructive pulmonary disease 237 0.00222575352151944
psoriasis 6685 0.00260162429651116
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00801513330448467
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0125071898910979
primary Sjogren syndrome 789 0.0140894483796822
cystic fibrosis 1670 0.0140976933700188
esophageal adenocarcinoma 737 0.0176010007179145
colon cancer 1475 0.0192407727948789
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0443178565108046
Disease Target Count Z-score Confidence
Cancer 2346 3.406 1.7
Inflammatory bowel disease 142 3.321 1.7

Expression

Synonym

Accession P18283 Q6PJ52 Q8WWI7 Q9NRP9 GPx-2
Symbols GPRP
GPx-2
GI-GPx
GPRP-2
GPx-GI
GSHPx-2
GSHPX-GI

Gene

PANTHER Protein Class (2)

PDB

2HE3  

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (35)

PMID Text
25813210 GPX2 underexpression is associated with advanced tumor status and implicated unfavorable clinical outcome of UCs, suggesting its role in tumor progression and may serve as a theranostic biomarker of UCs.
25261240 high GPx2 expression was associated with early tumor recurrence, particularly in the recently identified aggressive subtype of human colon cancer.
24562575 Patients with high GPX2 expression in biopsy specimen had significantly lower prostate-specific antigen recurrence-free survival and overall survival than those with no GPX2 expression.
23934683 miR-185 plays a role in up-regulation of GPX2 and SEPHS2 expression.
22758632 A GPx2-independent decrease in tumor development by selenium (Se) and detrimental effects of the Nrf2-activator sulforaphane in moderate Se deficiency.
22683372 A role of GPx2, TrxR2 and TrxR3 in proliferation, apoptosis and, therefore, also during cancer development.
20813000 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20200426 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPCNQ      1 - 70
FGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLI     71 - 140
IWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI                        141 - 190
//

Text Mined References (46)

PMID Year Title
25813210 2015 GPX2 underexpression indicates poor prognosis in patients with urothelial carcinomas of the upper urinary tract and urinary bladder.
25261240 2014 GPx2 suppression of H2O2 stress links the formation of differentiated tumor mass to metastatic capacity in colorectal cancer.
24562575 2014 GPX2 overexpression is involved in cell proliferation and prognosis of castration-resistant prostate cancer.
23934683 2013 Selenium alters miRNA profile in an intestinal cell line: evidence that miR-185 regulates expression of GPX2 and SEPSH2.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22758632 2012 Physiological functions of GPx2 and its role in inflammation-triggered carcinogenesis.
22683372 2012 The selenoproteins GPx2, TrxR2 and TrxR3 are regulated by Wnt signalling in the intestinal epithelium.
21269460 2011 Initial characterization of the human central proteome.
20813000 2010 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma in a pooled analysis of three studies.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...