Property Summary

NCBI Gene PubMed Count 49
PubMed Score 111.91
PubTator Score 58.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Tay-Sachs Disease, AB Variant 1 0.0 0.0
Disease Target Count Z-score Confidence
Gangliosidosis 20 0.0 4.0
Disease Target Count Z-score Confidence
Sandhoff disease 3 5.705 2.9
Candidiasis 55 4.349 2.2
inclusion-cell disease 16 3.464 1.7

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytoma 2.000 1.6e-02
atypical teratoid / rhabdoid tumor 1.200 6.8e-04
COPD -1.100 1.6e-03
cutaneous lupus erythematosus 1.200 4.1e-03
cystic fibrosis 1.100 1.1e-03
esophageal adenocarcinoma -2.100 1.8e-02
gastric cancer -1.700 1.3e-02
glioblastoma 1.800 1.5e-02
group 4 medulloblastoma -1.100 5.0e-03
lung cancer -1.100 9.5e-04
malignant mesothelioma -2.200 8.4e-08
medulloblastoma, large-cell 1.200 9.2e-05
osteosarcoma 2.251 4.5e-05
ovarian cancer -1.300 1.9e-07
Pick disease -1.300 2.0e-04
pituitary cancer 1.100 1.2e-04
primary Sjogren syndrome 1.200 3.4e-03
progressive supranuclear palsy -1.300 7.9e-03
psoriasis 1.600 4.4e-06
subependymal giant cell astrocytoma 1.266 1.5e-02
tuberculosis 2.100 5.8e-08
ulcerative colitis 1.400 1.5e-06
urothelial carcinoma -1.100 4.0e-02

Protein-protein Interaction (1)

Gene RIF (16)

AA Sequence

MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMG      1 - 70
STSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPF     71 - 140
KEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI                     141 - 193
//

Text Mined References (51)

PMID Year Title