Property Summary

NCBI Gene PubMed Count 46
Grant Count 9
R01 Count 9
Funding $630,182.17
PubMed Score 105.37
PubTator Score 58.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
gastric cancer -1.700 0.013
urothelial carcinoma -1.100 0.040
malignant mesothelioma -2.400 0.000
esophageal adenocarcinoma -2.100 0.018
psoriasis 2.800 0.000
cutaneous lupus erythematosus 1.200 0.004
osteosarcoma 2.377 0.000
astrocytoma 2.000 0.016
glioblastoma 1.800 0.015
atypical teratoid / rhabdoid tumor 1.200 0.001
medulloblastoma, large-cell 1.200 0.000
tuberculosis 2.100 0.000
lung cancer -1.600 0.000
cystic fibrosis 1.100 0.001
group 4 medulloblastoma -1.100 0.005
primary Sjogren syndrome 1.200 0.003
subependymal giant cell astrocytoma 1.266 0.015
COPD -1.400 0.002
Pick disease -1.300 0.000
progressive supranuclear palsy -1.300 0.008
ulcerative colitis 1.400 0.000
ovarian cancer 2.000 0.000
pituitary cancer 1.700 0.001

Gene RIF (13)

PMID Text
26175473 Mobilization of membrane lipids by GM2AP was also inhibited in the presence of cholesterol or SM, as revealed by surface plasmon resonance studies
25816011 Gene polymorphisms of MD2 and GM2A were associated with the occurrence or severity of neonatal necrotizing enterocolitis.
23483939 In vitro assays with the isolated H1 or H2 homodimers (beta-alpha hybrid construct of beta-hexosaminidase A subunits) confirmed that neither was capable of human GM2AP-dependent hydrolysis of GM2 ganglioside.
21784073 impact of GM2AP on glucose metabolism
21331553 Treatment of meniscal explants with IL-1RA inhibited the expression of many catabolic genes following a single bout of high dynamic strain.
21036149 these results provide novel insights into the physiological functions of GM2AP in obesity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of GM2 ganglioside activator (GM2A) by siRNA enhances HIV-1 replication in HeLa P4/R5 cells
17215249 glycosphingolipids, particularly GM2, form a complex with CD82, and this complex interacts with Met and thereby inhibits HGF-induced Met tyrosine kinase activity, as well as integrin to Met cross-talk
15485660 alpha-subunit loop structure is required for GM2 activator protein binding by beta-hexosaminidase A
More...

AA Sequence

MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMG      1 - 70
STSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPF     71 - 140
KEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI                     141 - 193
//

Publication (48)

PMID Year Title
26175473 2015 Membrane lipids regulate ganglioside GM2 catabolism and GM2 activator protein activity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25816011 2015 Association of neonatal necrotizing enterocolitis with myeloid differentiation-2 and GM2 activator protein genetic polymorphisms.
23568457 2013 Genetic variants associated with disordered eating.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23483939 2013 In cellulo examination of a beta-alpha hybrid construct of beta-hexosaminidase A subunits, reported to interact with the GM2 activator protein and hydrolyze GM2 ganglioside.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21784073 2011 Adipokine ganglioside GM2 activator protein stimulates insulin secretion.
21331553 2011 In vitro inhibition of compression-induced catabolic gene expression in meniscal explants following treatment with IL-1 receptor antagonist.
21036149 2010 A novel adipokine GM2AP impairs insulin signaling.
More...