Property Summary

NCBI Gene PubMed Count 59
PubMed Score 762.90
PubTator Score 565.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -3.900 1.6e-04
Down syndrome -1.200 1.6e-02
ependymoma -2.700 3.1e-02
facioscapulohumeral dystrophy 1.800 3.0e-02
glioblastoma 1.100 3.8e-02
group 3 medulloblastoma -1.600 2.7e-02
interstitial cystitis 2.000 9.3e-03
intraductal papillary-mucinous adenoma (... -2.100 3.2e-03
intraductal papillary-mucinous carcinoma... -1.900 6.6e-03
intraductal papillary-mucinous neoplasm ... -1.900 3.8e-02
Pick disease -1.700 2.8e-02
psoriasis -1.100 9.3e-03

Gene RIF (26)

AA Sequence

MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKD      1 - 70
EAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAET     71 - 140
ESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIE    141 - 210
AVDETKPKESARQDEGKEEEPEADQEHA                                              211 - 238
//

Text Mined References (61)

PMID Year Title