Property Summary

NCBI Gene PubMed Count 55
Grant Count 78
R01 Count 63
Funding $8,806,993.76
PubMed Score 732.18
PubTator Score 565.43

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P17677 A8K0Y4
Symbols B-50
PP46

Gene

Gene RIF (22)

PMID Text
26071889 The peripheral neuropathies lead to an initial increase in GAP-43 gene expression as a potential mechanism of regeneration, which is not sustained in neuropathies of long duration.
25755278 Results show that PKC-dependent phosphorylation of GAP43 plays a critical role in regulating postsynaptic gephyrin aggregation in developing GABAergic synapses.
24301786 increased expression of TH and GAP43 might be a molecular mechanism for left atrial myoelectricity remodeling of aging atrial fibrillation patients, which might be potential therapeutic targets of atrial fibrillation.
23887302 GAP43 is seemingly a highly sensitive marker for peripheral nerve sheath tumors
23524246 The results showed that the decreased GAP-43 levels induced by glutamate could be partially reversed by the presence of NRG-1beta
23396970 Dynamic palmitoylation links cytosol-membrane shuttling of acyl-protein thioesterase-1 and acyl-protein thioesterase-2 with that of proto-oncogene H-ras product and growth-associated protein-43
23153097 immunostaning for GAP-43 was relatively similar in ganglionic versus aganglionic colon.
22209024 Impaired regeneration of intra-epidermal C fibers in the early stages of type 2 diabetes mellitus, as indicated by GAP-43 expression, might be a marker of incipient diabetic neuropathy.
22138049 The results of this study supported to the hypothesis of multiple rare mutations in schizophrenia, and it provides genetic clues that indicate the involvement of GAP-43 in this disorder.
22082156 Knockdown of growth associated protein 43 (GAP43) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
More...

AA Sequence

MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKD      1 - 70
EAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAET     71 - 140
ESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIE    141 - 210
AVDETKPKESARQDEGKEEEPEADQEHA                                              211 - 238
//

Publication (57)

PMID Year Title
26071889 2015 Increased gene expression of growth associated protein-43 in skin of patients with early-stage peripheral neuropathies.
25755278 2015 Protein kinase C-dependent growth-associated protein 43 phosphorylation regulates gephyrin aggregation at developing GABAergic synapses.
24301786 2013 Expression of tyrosine hydroxylase and growth-associated protein 43 in aging atrial fibrillation patients of Xinjiang Uygur and Han nationality.
23887302 2014 Growth-associated protein 43 in differentiating peripheral nerve sheath tumors from other non-neural spindle cell neoplasms.
23524246 Effects of neuregulin-1? on growth-associated protein 43 expression in dorsal root ganglion neurons with excitotoxicity induced by glutamate in vitro.
23396970 2013 Dynamic palmitoylation links cytosol-membrane shuttling of acyl-protein thioesterase-1 and acyl-protein thioesterase-2 with that of proto-oncogene H-ras product and growth-associated protein-43.
23153097 Growth-associated protein 43 expression in ganglionic and aganglionic colon.
22209024 2012 Expression of growth-associated protein 43 in the skin nerve fibers of patients with type 2 diabetes mellitus.
22138049 2012 Genetic and functional analysis of the gene encoding GAP-43 in schizophrenia.
21769916 2011 Sphingosine kinase 1/S1P pathway involvement in the GDNF-induced GAP43 transcription.
More...