Property Summary

NCBI Gene PubMed Count 34
PubMed Score 62.51
PubTator Score 23.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.8e-03
glioblastoma 1.100 5.4e-03
intraductal papillary-mucinous neoplasm ... 1.700 3.5e-04
medulloblastoma, large-cell 1.500 9.1e-05
osteosarcoma 1.239 3.8e-05

Gene RIF (8)

AA Sequence

MGDDRPFVCNAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARTDSVIIADQTPTPTRFLKNCEEVGLFNEL      1 - 70
ASSFEHEFKKAADEDEKKARSRTVAKKLVAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPDSPASSPCSP     71 - 140
PLKEKEVTPKPVLISTPTPTIVRPGSLPLHLGYDPLHPTLPSPTSVITQAPPSNRQMGSPTGSLPLVMHL    141 - 210
ANGQTMPVLPGPPVQMPSVISLARPVSMVPNIPGIPGPPVNSSGSISPSGHPIPSEAKMRLKATLTHQVS    211 - 280
SINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFL    281 - 350
ERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLSNEVTLLRNEVAQLKQLLLAHKDCPVTALQKKTQG    351 - 420
YLESPKESSEPTGSPAPVIQHSSATAPSNGLSVRSAAEAVATSVLTQMASQRTELSMPIQSHVIMTPQSQ    421 - 490
SAGR                                                                      491 - 494
//

Text Mined References (44)

PMID Year Title