Property Summary

NCBI Gene PubMed Count 18
PubMed Score 61.07
PubTator Score 21.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Trichotillomania 7 4.359 2.2
obsessive-compulsive disorder 61 3.585 1.8
Disease Target Count P-value
psoriasis 6694 9.0e-23
ovarian cancer 8519 4.6e-03
interstitial cystitis 2312 5.0e-03
aldosterone-producing adenoma 665 1.8e-02

Expression

  Differential Expression (4)

Disease log2 FC p
aldosterone-producing adenoma 2.330 1.8e-02
interstitial cystitis -1.100 5.0e-03
ovarian cancer 1.300 4.6e-03
psoriasis -1.300 9.0e-23

Gene RIF (4)

AA Sequence

MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQ      1 - 70
QNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRP     71 - 140
QAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKF    141 - 210
PSSKCEQEELEKQKLERAPEAADEGDAQKGDKK                                         211 - 243
//

Text Mined References (18)

PMID Year Title