Property Summary

NCBI Gene PubMed Count 17
Grant Count 15
R01 Count 12
Funding $3,197,041.83
PubMed Score 57.73
PubTator Score 21.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial cystitis -1.100 0.005
aldosterone-producing adenoma 2.330 0.018
ovarian cancer 1.300 0.005
psoriasis -1.300 0.000

Gene RIF (3)

PMID Text
24727796 Results show that FMRP regulates miR196a-mediated repression of HOXB8 via interaction with the AGO2 MID domain.
23647300 HOXB8 and KLK11 may be classified as valuable biomarkers, as they can predict the effects of FOLFOX4 chemotherapy in primary advanced colorectal cancer patients
23438671 HOXB5 and HOXB8 are frequently expressed in ovarian serous carcinoma, with anatomic site-related differences for cytoplasmic staining. HOXB8 expression is associated with shorter survival in metastatic serous carcinoma.

AA Sequence

MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQ      1 - 70
QNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRP     71 - 140
QAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKF    141 - 210
PSSKCEQEELEKQKLERAPEAADEGDAQKGDKK                                         211 - 243
//

Text Mined References (17)

PMID Year Title
24727796 2014 FMRP regulates miR196a-mediated repression of HOXB8 via interaction with the AGO2 MID domain.
23647300 2013 Identification of HOXB8 and KLK11 expression levels as potential biomarkers to predict the effects of FOLFOX4 chemotherapy.
23438671 2013 HOXB8 expression in ovarian serous carcinoma effusions is associated with shorter survival.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11857506 2002 Complete mutation analysis panel of the 39 human HOX genes.
11779477 2002 Hoxb8 is required for normal grooming behavior in mice.
11571641 2001 HoxB8 requires its Pbx-interaction motif to block differentiation of primary myeloid progenitors and of most cell line models of myeloid differentiation.
11438208 2001 Inhibition of myeloid differentiation by Hoxa9, Hoxb8, and Meis homeobox genes.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9126347 1997 Human colorectal carcinogenesis is associated with deregulation of homeobox gene expression.
More...