Property Summary

NCBI Gene PubMed Count 99
PubMed Score 62.84
PubTator Score 729.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 7.06760252531474E-16
pituitary cancer 1972 8.06693332649306E-8
chronic lymphosyte leukemia 232 1.68306658925706E-7
psoriasis 6685 6.74501487527229E-7
lung carcinoma 2844 7.23226989872135E-6
adrenocortical carcinoma 1427 7.7088562579633E-6
lung cancer 4473 4.90096047960635E-5
nephrosclerosis 329 2.10491633483957E-4
ovarian cancer 8492 2.77232982775955E-4
Multiple Sclerosis 498 0.00130594737634817
glioblastoma 5572 0.00158075499785859
inflammatory breast cancer 404 0.00217090160829482
group 4 medulloblastoma 1875 0.00277797403782972
non diabetic and post-ischemic heart failure 200 0.0030375431286926
pancreatic cancer 2300 0.00631145374289238
mucosa-associated lymphoid tissue lymphoma 480 0.00631502792917161
gastric cancer 436 0.00646390935176158
astrocytoma 1493 0.00657224839968206
posterior fossa group B ependymoma 1530 0.0106057358808596
pterygium 74 0.0156518892013171
pancreatic carcinoma 567 0.0176404349234942
acute myeloid leukemia 785 0.0216338123196836
primary pancreatic ductal adenocarcinoma 1271 0.0267343109539188
Disease Target Count Z-score Confidence
Cancer 2346 3.182 1.6

Expression

  Differential Expression (23)

Disease log2 FC p
nephrosclerosis -1.232 0.000
gastric cancer -1.600 0.006
pancreatic cancer 2.100 0.006
psoriasis -1.500 0.000
chronic lymphosyte leukemia -1.700 0.000
group 4 medulloblastoma -2.000 0.003
astrocytoma 2.200 0.007
glioblastoma 2.300 0.002
non diabetic and post-ischemic heart fai... -1.400 0.003
adrenocortical carcinoma -1.634 0.000
primary pancreatic ductal adenocarcinoma 1.782 0.027
non-small cell lung cancer -1.448 0.000
lung cancer -2.600 0.000
Multiple Sclerosis 1.200 0.001
posterior fossa group B ependymoma -1.200 0.011
pancreatic carcinoma -1.400 0.018
inflammatory breast cancer -1.900 0.002
lung carcinoma -1.400 0.000
pterygium -1.400 0.016
mucosa-associated lymphoid tissue lympho... 1.440 0.006
acute myeloid leukemia 2.000 0.022
ovarian cancer 1.200 0.000
pituitary cancer -3.000 0.000

Synonym

Accession P17275 Q96GH3
Symbols AP-1

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Gene RIF (65)

PMID Text
26926107 ETS2, HNF4A and JUNB are synergistic master regulators of epithelial-to-mesenchymal transition in cancer.
26754630 Results suggested that JunB could play an important role in promoting cell invasion, migration and distant metastasis in head and neck squamous cell carcinoma via pathways other than epithelial-to-mesenchymal transition.
26747248 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26725775 Our findings demonstrate that miRNA-149* may serve as an oncogenic regulator in T-cell acute lymphoblastic leukemia by negatively regulating JunB
26658840 Highly recurrent mutation of JUNB is associated with nodular lymphocyte predominant Hodgkin lymphoma.
26318166 PDK1 functions as a tumor promoter in human gallbladder cancer by upregulating JunB, promoting epithelial mesenchymal transformation, and cell migration.
26217035 JunB is likely to be a key target of c-Abl in expression of p21 in Adriamycin-induced DDR.
25753664 Caveolin 2 disengages repressed Egr-1 and JunB promoters from lamin A/C through disassembly of H3K9me3 in the inner nuclear membrane.
25662951 The MAPK pathway plays a primary role in the control of JUNB gene expression.
25613138 The gene expression of JunB is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
More...

AA Sequence

MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFS      1 - 70
GQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFV     71 - 140
KALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPT    141 - 210
TTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRL    211 - 280
AATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF       281 - 347
//

Text Mined References (109)

PMID Year Title
26926107 2016 Synergistic action of master transcription factors controls epithelial-to-mesenchymal transition.
26754630 2016 JunB promotes cell invasion, migration and distant metastasis of head and neck squamous cell carcinoma.
26747248 2016 CARMA1- and MyD88-dependent activation of Jun/ATF-type AP-1 complexes is a hallmark of ABC diffuse large B-cell lymphomas.
26725775 2016 miRNA-149* promotes cell proliferation and suppresses apoptosis by mediating JunB in T-cell acute lymphoblastic leukemia.
26658840 2016 Highly recurrent mutations of SGK1, DUSP2 and JUNB in nodular lymphocyte predominant Hodgkin lymphoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26318166 2015 PDK1 induces JunB, EMT, cell migration and invasion in human gallbladder cancer.
26217035 2015 c-Abl-mediated tyrosine phosphorylation of JunB is required for Adriamycin-induced expression of p21.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
More...