Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.15
PubTator Score 4.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 2.28303107757524E-5
ovarian cancer 8492 1.51214480199638E-4
Disease Target Count Z-score Confidence
Viral encephalitis 2 3.318 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
ovarian cancer 1.500 0.000

Synonym

Accession P17041 Q92951
Symbols KOX30

Gene

PDB

2EPC   2EPT   2EPU   2YTA   2YTB  

  Ortholog (7)

Gene RIF (2)

PMID Text
26497555 Sp1-ZNF32-C1QBP axis protects against oxidative stress/apoptosis in hepatocellular carcinoma cells.
25786368 ZNF32 acts as an effective autophagy inhibitor to protect breast cancer cells from excessive stimulus-autophagy-induced cell death.

AA Sequence

MFGFPTATLLDCHGRYAQNVAFFNVMTEAHHKYDHSEATGSSSWDIQNSFRREKLEQKSPDSKTLQEDSP      1 - 70
GVRQRVYECQECGKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNLVTHQRIHTGEKPYQCKECGK     71 - 140
SFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHRRVHSGEKPYRCDQCGKAFSQKGSLIVHIRV    141 - 210
HTGLKPYACTQCRKSFHTRGNCILHGKIHTGETPYLCGQCGKSFTQRGSLAVHQRSCSQRLTL           211 - 273
//

Text Mined References (11)

PMID Year Title
26497555 2015 ZNF32 protects against oxidative stress-induced apoptosis by modulating C1QBP transcription.
25786368 2015 ZNF32 inhibits autophagy through the mTOR pathway and protects MCF-7 cells from stimulus-induced cell death.
25416956 2014 A proteome-scale map of the human interactome network.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9475118 1997 C2H2-546: a zinc finger protein differentially expressed in HTLV-1 infected T cells.
8500793 1993 Human zinc finger gene ZNF23 (Kox16) maps to a zinc finger gene cluster on chromosome 16q22, and ZNF32 (Kox30) to chromosome region 10q23-q24.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
More...