Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.15
PubTator Score 4.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
ovarian cancer 1.500 0.000

Gene RIF (2)

PMID Text
26497555 Sp1-ZNF32-C1QBP axis protects against oxidative stress/apoptosis in hepatocellular carcinoma cells.
25786368 ZNF32 acts as an effective autophagy inhibitor to protect breast cancer cells from excessive stimulus-autophagy-induced cell death.

AA Sequence

MFGFPTATLLDCHGRYAQNVAFFNVMTEAHHKYDHSEATGSSSWDIQNSFRREKLEQKSPDSKTLQEDSP      1 - 70
GVRQRVYECQECGKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNLVTHQRIHTGEKPYQCKECGK     71 - 140
SFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHRRVHSGEKPYRCDQCGKAFSQKGSLIVHIRV    141 - 210
HTGLKPYACTQCRKSFHTRGNCILHGKIHTGETPYLCGQCGKSFTQRGSLAVHQRSCSQRLTL           211 - 273
//

Text Mined References (11)

PMID Year Title
26497555 2015 ZNF32 protects against oxidative stress-induced apoptosis by modulating C1QBP transcription.
25786368 2015 ZNF32 inhibits autophagy through the mTOR pathway and protects MCF-7 cells from stimulus-induced cell death.
25416956 2014 A proteome-scale map of the human interactome network.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9475118 1997 C2H2-546: a zinc finger protein differentially expressed in HTLV-1 infected T cells.
8500793 1993 Human zinc finger gene ZNF23 (Kox16) maps to a zinc finger gene cluster on chromosome 16q22, and ZNF32 (Kox30) to chromosome region 10q23-q24.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
More...