Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.15
PubTator Score 4.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.6e-07
malignant mesothelioma 3232 2.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Viral encephalitis 2 3.319 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -1.100 2.3e-05
ovarian cancer -1.300 1.6e-07

Gene RIF (3)

AA Sequence

MFGFPTATLLDCHGRYAQNVAFFNVMTEAHHKYDHSEATGSSSWDIQNSFRREKLEQKSPDSKTLQEDSP      1 - 70
GVRQRVYECQECGKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNLVTHQRIHTGEKPYQCKECGK     71 - 140
SFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHRRVHSGEKPYRCDQCGKAFSQKGSLIVHIRV    141 - 210
HTGLKPYACTQCRKSFHTRGNCILHGKIHTGETPYLCGQCGKSFTQRGSLAVHQRSCSQRLTL           211 - 273
//

Text Mined References (12)

PMID Year Title