Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.04
PubTator Score 2.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
group 4 medulloblastoma 1875 3.73130026195978E-9
atypical teratoid/rhabdoid tumor 1095 3.85171950464596E-8
malignant mesothelioma 3163 1.56649584403411E-5
psoriasis 6685 6.66003239915274E-5
primitive neuroectodermal tumor 3031 1.15116097130115E-4
pituitary cancer 1972 1.18493505015164E-4
medulloblastoma, large-cell 6234 4.00422936458469E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 4.71037595965526E-4
pediatric high grade glioma 2712 5.14775310387243E-4
lung cancer 4473 6.17893931138332E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00101565642748227
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00197717084801326
ependymoma 2514 0.00681719534503935
astrocytic glioma 2241 0.0253863362245723
adrenocortical carcinoma 1427 0.0409054362493978
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Ewing sarcoma 27 3.013 1.5

Expression

Synonym

Accession P17038 A8K5N8 P28160 Q53XQ2 Q5H9T3 Q96DG1
Symbols HTF6
KOX27
ZNF39L1

Gene

Gene RIF (1)

PMID Text
17178891 Human embryo kidney cells that overexpressed AAK1 are adriamycin resistant

AA Sequence

MGPLTFMDVAIEFCLEEWQCLDIAQQNLYRNVMLENYRNLVFLGIAVSKPDLITCLEQEKEPWEPMRRHE      1 - 70
MVAKPPVMCSHFTQDFWPEQHIKDPFQKATLRRYKNCEHKNVHLKKDHKSVDECKVHRGGYNGFNQCLPA     71 - 140
TQSKIFLFDKCVKAFHKFSNSNRHKISHTEKKLFKCKECGKSFCMLPHLAQHKIIHTRVNFCKCEKCGKA    141 - 210
FNCPSIITKHKRINTGEKPYTCEECGKVFNWSSRLTTHKKNYTRYKLYKCEECGKAFNKSSILTTHKIIR    211 - 280
TGEKFYKCKECAKAFNQSSNLTEHKKIHPGEKPYKCEECGKAFNWPSTLTKHKRIHTGEKPYTCEECGKA    281 - 350
FNQFSNLTTHKRIHTAEKFYKCTECGEAFSRSSNLTKHKKIHTEKKPYKCEECGKAFKWSSKLTEHKLTH    351 - 420
TGEKPYKCEECGKAFNWPSTLTKHNRIHTGEKPYKCEVCGKAFNQFSNLTTHKRIHTAEKPYKCEECGKA    421 - 490
FSRSSNLTKHKKIHIEKKPYKCEECGKAFKWSSKLTEHKITHTGEKPYKCEECGKAFNHFSILTKHKRIH    491 - 560
TGEKPYKCEECGKAFTQSSNLTTHKKIHTGEKFYKCEECGKAFTQSSNLTTHKKIHTGGKPYKCEECGKA    561 - 630
FNQFSTLTKHKIIHTEEKPYKCEECGKAFKWSSTLTKHKIIHTGEKPYKCEECGKAFKLSSTLSTHKIIH    631 - 700
TGEKPYKCEKCGKAFNRSSNLIEHKKIHTGEQPYKCEECGKAFNYSSHLNTHKRIHTKEQPYKCKECGKA    701 - 770
FNQYSNLTTHNKIHTGEKLYKPEDVTVILTTPQTFSNIK                                   771 - 809
//

Text Mined References (17)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17178891 2006 Endocytic Ark/Prk kinases play a critical role in adriamycin resistance in both yeast and mammalian cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...