Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.16
PubTator Score 2.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 8.2e-06
osteosarcoma 7950 5.4e-05
medulloblastoma, large-cell 6241 1.5e-04
glioblastoma 5792 3.7e-03
adult high grade glioma 3801 7.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Myotonic dystrophy type 1 17 4.068 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.600 7.5e-03
glioblastoma -1.400 3.7e-03
medulloblastoma, large-cell -1.500 1.5e-04
osteosarcoma 1.994 5.4e-05
ovarian cancer -1.600 8.2e-06

Gene RIF (1)

AA Sequence

MITSQGSVSFRDVTVGFTQEEWQHLDPAQRTLYRDVMLENYSHLVSVGYCIPKPEVILKLEKGEEPWILE      1 - 70
EKFPSQSHLELINTSRNYSIMKFNEFNKGGKCFCDEKHEIIHSEEEPSEYNKNGNSFWLNEDLIWHQKIK     71 - 140
NWEQSFEYNECGKAFPENSLFLVHKRGYTGQKTCKYTEHGKTCDMSFFITHQQTHPRENHYGNECGENIF    141 - 210
EESILLEHQSVYPFSQKLNLTPIQRTHSINNIIEYNECGTFFSEKLVLHLQQRTHTGEKPYECHECGKTF    211 - 280
TQKSAHTRHQRTHTGGKPYECHECGKTFYKNSDLIKHQRIHTGERPYGCHECGKSFSEKSTLTQHQRTHT    281 - 350
GEKPYECHECGKTFSFKSVLTVHQKTHTGEKPYECYACGKAFLRKSDLIKHQRIHTGEKPYECNECGKSF    351 - 420
SEKSTLTKHLRTHTGEKPYECIQCGKFFCYYSGFTEHLRRHTGEKPFGCNECGKTFRQKSALIVHQRTHI    421 - 490
RQKPYGCNQCGKSFCVKSKLIAHHRTHTGEKPYECNVCGKSFYVKSKLTVHQRIHLGRNPINVVNEGNYS    491 - 560
G//

Text Mined References (9)

PMID Year Title