Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.25
PubTator Score 1.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 5.6e-03
atypical teratoid / rhabdoid tumor -1.800 1.7e-04
ependymoma -1.100 7.6e-05
glioblastoma -1.600 2.1e-05
lung carcinoma 1.300 5.2e-22
medulloblastoma, large-cell -2.200 6.6e-04
ovarian cancer -1.200 7.1e-05
Pick disease -1.100 2.0e-02

Gene RIF (2)

AA Sequence

MNKFQGPVTLKDVIVEFTKEEWKLLTPAQRTLYKDVMLENYSHLVSVGYHVNKPNAVFKLKQGKEPWILE      1 - 70
VEFPHRGFPEDLWSIHDLEARYQESQAGNSRNGELTKHQKTHTTEKACECKECGKFFCQKSALIVHQHTH     71 - 140
SKGKSYDCDKCGKSFSKNEDLIRHQKIHTRDKTYECKECKKIFYHLSSLSRHLRTHAGEKPYECNQCEKS    141 - 210
FYQKPHLTEHQKTHTGEKPFECTECGKFFYVKAYLMVHQKTHTGEKPYECKECGKAFSQKSHLTVHQRMH    211 - 280
TGEKPYKCKECGKFFSRNSHLKTHQRSHTGEKPYECKECRKCFYQKSALTVHQRTHTGEKPFECNKCGKT    281 - 350
FYYKSDLTKHQRKHTGEKPYECTECGKSFAVNSVLRLHQRTHTGEKPYACKECGKSFSQKSHFIIHQRKH    351 - 420
TGEKPYECQECGETFIQKSQLTAHQKTHTKKRNAEK                                      421 - 456
//

Text Mined References (15)

PMID Year Title