Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.46
PubTator Score 0.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 4 medulloblastoma 1875 7.16736931617151E-7
medulloblastoma, large-cell 6234 4.6797731401126E-4
ependymoma 2514 0.00208819091842223
oligodendroglioma 2849 0.00341416271518231
astrocytic glioma 2241 0.00702079304488519

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.200 0.007
ependymoma 1.900 0.002
oligodendroglioma 1.300 0.003
group 4 medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.100 0.000

Synonym

Accession P17023 A8K895 Q86Y66 Q8NDE2 Q96M79 Q96NE5
Symbols KOX12

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG

AA Sequence

MAAMPLKAQYQEMVTFEDVAVHFTKTEWTGLSPAQRALYRSVMLENFGNLTALGYPVPKPALISLLERGD      1 - 70
MAWGLEAQDDPPAERTKNVCKDVETNIDSESTLIQGISEERDGMMSHGQLKSVPQRTDFPETRNVEKHQD     71 - 140
IPTVKNIQGKVPRIPCARKPFICEECGKSFSYFSYYARHQRIHTGEKPFECSECGKAFNGNSSLIRHQRI    141 - 210
HTGERPYQCEECGRAFNDNANLIRHQRIHSGDRPYYCTECGNSFTSSSEFVIHQRIHTGEKPYECNECGK    211 - 280
AFVGNSPLLRHQKIHTGEKPYECNECGKSFGRTSHLSQHQRIHTGEKPYSCKVCGQAFNFHTKLTRHQRI    281 - 350
HSEEKPFDCVDCGKAFSAQEQLKRHLRIHTQESSYVCDECGKALTSKRNLHQHQRIHTGEKPYECSKYEK    351 - 420
AFGTSSQLGHLEHVYSGEKPVLDICRFGLPEFFTPFYW                                    421 - 458
//

Text Mined References (12)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7557990 1995 Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
More...