Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.46
PubTator Score 0.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.200 7.0e-03
ependymoma 1.900 2.1e-03
group 4 medulloblastoma 1.500 7.2e-07
medulloblastoma, large-cell 1.100 4.7e-04
oligodendroglioma 1.300 3.4e-03

AA Sequence

MAAMPLKAQYQEMVTFEDVAVHFTKTEWTGLSPAQRALYRSVMLENFGNLTALGYPVPKPALISLLERGD      1 - 70
MAWGLEAQDDPPAERTKNVCKDVETNIDSESTLIQGISEERDGMMSHGQLKSVPQRTDFPETRNVEKHQD     71 - 140
IPTVKNIQGKVPRIPCARKPFICEECGKSFSYFSYYARHQRIHTGEKPFECSECGKAFNGNSSLIRHQRI    141 - 210
HTGERPYQCEECGRAFNDNANLIRHQRIHSGDRPYYCTECGNSFTSSSEFVIHQRIHTGEKPYECNECGK    211 - 280
AFVGNSPLLRHQKIHTGEKPYECNECGKSFGRTSHLSQHQRIHTGEKPYSCKVCGQAFNFHTKLTRHQRI    281 - 350
HSEEKPFDCVDCGKAFSAQEQLKRHLRIHTQESSYVCDECGKALTSKRNLHQHQRIHTGEKPYECSKYEK    351 - 420
AFGTSSQLGHLEHVYSGEKPVLDICRFGLPEFFTPFYW                                    421 - 458
//

Text Mined References (12)

PMID Year Title