Property Summary

NCBI Gene PubMed Count 32
PubMed Score 143.06
PubTator Score 66.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 1.200 5.0e-10
Breast cancer -1.600 1.4e-05
Chronic Lymphocytic Leukemia 1.736 1.0e-03
ependymoma 1.200 1.2e-06
esophageal adenocarcinoma -1.300 1.9e-02
glioblastoma 2.600 1.2e-03
group 3 medulloblastoma -1.400 2.7e-02
intraductal papillary-mucinous neoplasm ... -2.500 4.3e-02
invasive ductal carcinoma -1.128 4.5e-04
lung cancer -1.600 1.6e-04
lung carcinoma -2.400 6.1e-31
ovarian cancer -1.200 2.3e-04
pancreatic ductal adenocarcinoma liver m... 2.889 6.6e-04
pediatric high grade glioma 1.300 1.9e-04
Pick disease 1.400 3.4e-02
pituitary cancer -4.100 3.3e-12
spina bifida -1.512 3.7e-02
subependymal giant cell astrocytoma 2.107 1.7e-02

Gene RIF (14)

AA Sequence

MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAA      1 - 70
ASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGET     71 - 140
VEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPP    141 - 210
ATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGP    211 - 280
VHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGK    281 - 350
EAKAGEAPTENPAPPTQQSSAE                                                    351 - 372
//

Text Mined References (43)

PMID Year Title