Property Summary

NCBI Gene PubMed Count 28
Grant Count 111
R01 Count 36
Funding $21,570,451.05
PubMed Score 141.78
PubTator Score 66.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession P16989 B2RBW6 Q14121 Q969N6 Q96B76
Symbols CSDA
DBPA
CSDA1
ZONAB

Gene

Gene RIF (12)

PMID Text
24885929 Stratification according to Fuhrman grade disclosed higher YBX3 expression levels.
24817634 In the prenatal brain, the cold shock domain protein A were found to be abundantly expressed in radial glial cells, neuroblasts and neurons.
22711822 We demonstrate that ZONAB promotes cell survival in response to proinflammatory, hyperosmotic, and cytotoxic stress and that stress-induced ZONAB activation involves the Rho regulator GEF-H1.
22159460 DbpA promoter was methylated in 37.7% of HCC samples.
21473684 In human skeletal muscle cells, CSDA was upregulated during hypoxia when cells were damaged and apoptosis was induced.
20133480 ZONAB is an important component of the mechanisms that sense epithelial density and participates in the complex transcriptional networks that regulate the switch between proliferation and differentiation
19749785 The expression of human DBPA was upregulated in gastric cancer tissues and cell lines. siRNA treatment successfully silenced DBPA expression.
19328795 The symplekin/ZONAB complex inhibits intestinal cell differentiation by the repression of AML1/Runx1.
19240061 Observational study of gene-disease association. (HuGE Navigator)
16508013 ZONAB regulates the transcription of genes that are important for G1/S-phase progression and links tight junctions to the transcriptional control of key cell cycle regulators and epithelial cell differentiation.
More...

AA Sequence

MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAA      1 - 70
ASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGET     71 - 140
VEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPP    141 - 210
ATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGP    211 - 280
VHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGK    281 - 350
EAKAGEAPTENPAPPTQQSSAE                                                    351 - 372
//

Text Mined References (38)

PMID Year Title
24885929 2014 Validation of housekeeping gene and impact on normalized gene expression in clear cell renal cell carcinoma: critical reassessment of YBX3/ZONAB/CSDA expression.
24817634 2015 Differential distribution of Y-box-binding protein 1 and cold shock domain protein A in developing and adult human brain.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22711822 2012 Stress- and Rho-activated ZO-1-associated nucleic acid binding protein binding to p21 mRNA mediates stabilization, translation, and cell survival.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22159460 2012 DNA binding protein A expression and methylation status in hepatocellular carcinoma and the adjacent tissue.
21473684 2011 Critical roles of cold shock domain protein A as an endogenous angiogenesis inhibitor in skeletal muscle.
More...