Property Summary

NCBI Gene PubMed Count 401
PubMed Score 2598.83
PubTator Score 2239.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
periodontitis 269 7.35775934578389E-19
non-small cell lung cancer 2798 1.39843936462487E-15
lung cancer 4473 2.89293984794978E-6
lung adenocarcinoma 2714 5.93891103146135E-5
ulcerative colitis 2087 1.83536762664943E-4
non diabetic and post-ischemic heart failure 200 9.6598978242646E-4
interstitial cystitis 2299 0.00272576291320204
Atopic dermatitis 944 0.00621775565735376
ductal carcinoma in situ 1745 0.00713612237487458
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00843521498715536
type II diabetes mellitus and post-ischemic heart failure 89 0.0117478543402274
cutaneous lupus erythematosus 1056 0.0261130126489092
head and neck cancer 270 0.0494336278636452

Expression

Synonym

Accession P16581 A2RRD6 P16111
Symbols ELAM
ESEL
CD62E
ELAM1
LECAM2

Gene

PDB

1ESL   1G1T   1KJA   4C16   4CSY  

  Ortholog (7)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
686992 screening 963 / 1107 / 258294 Identification of agents that induce E-selectin on human endothelial cells Measured in Cell-Based System Using Imaging - 2152-01_Activator_SinglePoint_HTS_Activity
977605 confirmatory 17 / 21 / 737 Identification of agents that induce E-selectin on human endothelial cells Measured in Cell-Based System Using Imaging - 2152-01_Activator_Dose_CherryPick_Activity

Gene RIF (403)

PMID Text
26988221 Inhibition of E-selectin expression allows an anti-tumoral effect on sLex-expressing hepatocellular carcinoma tumors in vivo
26937892 These findings provide consistent evidence that A516C and G98T polymorphisms of the SELE gene may be associated with increased susceptibility of coronary artery disease.
26872904 BD patients have a lower expression of ICAM-1, VCAM-1, and E-selectin in their tumor tissues. BD-HDL facilitates the adhesion of tumor cells to vascular endothelium by upregulating the expression of ICAM-1 and VCAM-1, thereby promoting the initial progression of breast cancer metastasis
26868209 Glycosphingolipids likely contribute to human myeloid cell adhesion to E-selectin under fluid shear, particularly the transition of rolling cells to firm arrest.
26828984 The E-selectin S149R polymorphisms is associated with the oncogenesis of breast cancer.
26617843 E-selectin is more effective than cTnI in diagnosing myocardial injury in children.
26396484 Glaucomatous MYOC mutations activate the IL-1beta/NF-kappaB inflammatory stress response and the glaucoma marker SELE in trabecular meshwork cells.
26329844 Data show that both mucin16 (MUC16) and podocalyxin (PODXL)-E-selectin-mediated interactions are mechanically stronger than like L-selectin interactions at the single-molecule level.
26153406 Neisseria meningitidis caused a high level of E-selectin expression elicited by the activity of phosphorylated ATF2 transcription factor on the E-selectin promoter.
26124272 E-selectin interactions with glycoprotein ligands (CD44/hematopoietic cell E-/L-selectin ligand and PSGL-1) mediate the initial capturing of cells out of flow.
More...

AA Sequence

MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYY      1 - 70
WIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYT     71 - 140
AACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISC    141 - 210
DRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMG    211 - 280
AQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECT    281 - 350
TQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN    351 - 420
EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQV    421 - 490
VKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAG    491 - 560
LSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL                        561 - 610
//

Text Mined References (405)

PMID Year Title
26988221 2016 Inhibition of E-selectin expression on the surface of endothelial cells inhibits hepatocellular carcinoma growth by preventing tumor angiogenesis.
26937892 2016 Relationship of SELE A561C and G98T Variants With the Susceptibility to CAD.
26872904 2016 High-density lipoprotein of patients with breast cancer complicated with type 2 diabetes mellitus promotes cancer cells adhesion to vascular endothelium via ICAM-1 and VCAM-1 upregulation.
26868209 2016 Glycosphingolipids on Human Myeloid Cells Stabilize E-Selectin-Dependent Rolling in the Multistep Leukocyte Adhesion Cascade.
26828984 2016 The E-selectin S149R polymorphisms in breast cancer in a northern Iran population.
26617843 2015 Role of E-selectin for diagnosis of myocardial injury in children of age up to 14 years.
26396484 2015 Glaucomatous MYOC mutations activate the IL-1/NF-?B inflammatory stress response and the glaucoma marker SELE in trabecular meshwork cells.
26329844 2015 Distinct kinetic and mechanical properties govern mucin 16- and podocalyxin-mediated tumor cell adhesion to E- and L-selectin in shear flow.
26153406 2016 A critical role for ATF2 transcription factor in the regulation of E-selectin expression in response to non-endotoxin components of Neisseria meningitidis.
26124272 2015 Quantitative Characterization of E-selectin Interaction with Native CD44 and P-selectin Glycoprotein Ligand-1 (PSGL-1) Using a Real Time Immunoprecipitation-based Binding Assay.
More...