Property Summary

Ligand Count 106
NCBI Gene PubMed Count 415
PubMed Score 2672.11
PubTator Score 2239.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
IGA Glomerulonephritis 50
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis 1.500 1.2e-15
Atopic dermatitis 1.900 6.2e-03
cutaneous lupus erythematosus 1.700 2.6e-02
ductal carcinoma in situ 1.300 7.1e-03
head and neck cancer 1.900 4.9e-02
interstitial cystitis 3.200 2.7e-03
lung adenocarcinoma -1.200 1.7e-03
lung cancer -2.700 4.6e-04
non diabetic and post-ischemic heart fai... -1.700 9.7e-04
non-small cell lung cancer -3.605 1.4e-15
pancreatic ductal adenocarcinoma liver m... -1.116 8.4e-03
periodontitis 1.200 7.4e-19
type II diabetes mellitus and post-ische... -1.800 1.2e-02
ulcerative colitis 3.000 1.8e-04

Protein-protein Interaction (6)

Gene RIF (416)

AA Sequence

MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYY      1 - 70
WIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYT     71 - 140
AACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISC    141 - 210
DRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMG    211 - 280
AQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECT    281 - 350
TQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN    351 - 420
EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQV    421 - 490
VKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAG    491 - 560
LSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL                        561 - 610
//

Text Mined References (419)

PMID Year Title