Property Summary

Ligand Count 34
NCBI Gene PubMed Count 589
PubMed Score 1426.94
PubTator Score 2002.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 9.3e-04
astrocytic glioma -1.500 1.5e-02
malignant mesothelioma 4.600 9.1e-09
oligodendroglioma -1.400 2.7e-02
osteosarcoma -1.785 1.2e-04
tuberculosis 1.300 2.5e-08

Gene RIF (577)

AA Sequence

MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYF      1 - 70
HQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVP     71 - 140
ILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN       141 - 207
//

Text Mined References (592)

PMID Year Title